PDB entry 5is2

View 5is2 on RCSB PDB site
Description: crystal structure of mycobacterium avium serb2 at ph 6.6
Deposited on 2016-03-15, released 2016-04-27
The last revision was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine Phosphatase
    Species: Mycobacterium avium (strain 104) [TaxId:243243]
    Gene: serB, MAV_3907
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QJI1 (0-395)
      • engineered mutation (26)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5is2A (A:)
    pkvsvlitvtgvdqpgvtatlfevlsrhgvellnveqvvirhrltlgvlvccpadvadgp
    alrhdveaairkvgldvsiersddvpiirepsthtifvlgrpitaaafgavarevaalgv
    nidlirgvsdypviglelrvsvppgadgalrtalnrvsseehvdvavedytlerrakrli
    vfdvdstlvqgeviemlaakagaegqvaaitdaamrgeldfaqslqqrvatlaglpatvi
    devagqlelmpgarttlrtlrrlgyacgvvsggfrriieplaeelmldyvaaneleivdg
    tltgrvvgpiidragkatalrefaqragvpmaqtvavgdgandidmlaaaglgiafnakp
    alrevadaslshpyldtvlfllgvtrgeieaadaid
    

    Sequence, based on observed residues (ATOM records):
    >5is2A (A:)
    pkvsvlitvtgvdqpgvtatlfevlsrhgvellnveqvvirhrltlgvlvccpadvadgp
    alrhdveaairkvgldvsiersddvpiirepsthtifvlgrpitaaafgavarevaalgv
    nidlirgvsdypviglelrvsvppgadgalrtalnrvsseehvdvavedytlerrakrli
    vfdvdstlvqgeviemlaakagaegqvaitdaamrgeldfaqslqqrvatlaglpatvid
    evagqlelmpgarttlrtlrrlgyacgvvsggfrriieplaeelmldyvaaneleivdgt
    ltgrvvgpiidragkatalrefaqragvpmaqtvavgdgandidmlaaaglgiafnakpa
    lrevadaslshpyldtvlfllgvtrgeieaadaid