PDB entry 5irv

View 5irv on RCSB PDB site
Description: human cytochrome p450 17a1 bound to inhibitor vt-464
Deposited on 2016-03-14, released 2017-03-15
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17A1, CYP17, S17AH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17A1, CYP17, S17AH
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17A1, CYP17, S17AH
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Steroid 17-alpha-hydroxylase/17,20 lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP17A1, CYP17, S17AH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, 6D8

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5irvA (A:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >5irvA (A:)
    llslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikkg
    kdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdgdqklekiicqei
    stlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnls
    kdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqak
    mnsdngpdqdsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeeid
    qnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgtevi
    inlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqelf
    limawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5irvB (B:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >5irvB (B:)
    llslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikkg
    kdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdgdqklekiicqei
    stlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnls
    kdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqak
    mnsdngpdqdsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeeid
    qnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgtevi
    inlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqelf
    limawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaqa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5irvC (C:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >5irvC (C:)
    sllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikk
    gkdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdgdqklekiicqe
    istlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnl
    skdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqa
    kmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkkly
    eeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkg
    teviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilar
    qelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaqa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5irvD (D:)
    makktgakypksllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivgh
    hqlakevlikkgkdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdg
    dqklekiicqeistlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnvi
    qnynegiidnlskdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsds
    itnmldtlmqakmnsdngnagpdqdsellsdnhilttigdifgagvetttsvvkwtlafl
    lhnpqvkkklyeeidqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvd
    ssigefavdkgteviinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgag
    prscigeilarqelflimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqa
    wreaqaegsthhhh
    

    Sequence, based on observed residues (ATOM records):
    >5irvD (D:)
    sllslplvgslpflprhghmhnnffklqkkygpiysvrmgtkttvivghhqlakevlikk
    gkdfsgrpqmatldiasnnrkgiafadsgahwqlhrrlamatfalfkdgdqklekiicqe
    istlcdmlathngqsidisfpvfvavtnvislicfntsykngdpelnviqnynegiidnl
    skdslvdlvpwlkifpnktleklkshvkirndllnkilenykekfrsdsitnmldtlmqa
    kmnsdngpdqdsellsdnhilttigdifgagvetttsvvkwtlafllhnpqvkkklyeei
    dqnvgfsrtptisdrnrlllleatirevlrlrpvapmliphkanvdssigefavdkgtev
    iinlwalhhnekewhqpdqfmperflnpagtqlispsvsylpfgagprscigeilarqel
    flimawllqrfdlevpddgqlpslegipkvvflidsfkvkikvrqawreaqa