PDB entry 5iru

View 5iru on RCSB PDB site
Description: Crystal structure of avidin in complex with 1-biotinylpyrene
Class: biotin binding protein
Keywords: complex, biotin binding protein
Deposited on 2016-03-14, released 2016-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.06: d5irua_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.06: d5irub_
  • Chain 'C':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.06: d5iruc_
  • Chain 'D':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.06: d5irud_
  • Heterogens: NAG, B9P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iruA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iruA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iruB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iruB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iruC (C:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iruC (C:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iruD (D:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iruD (D:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlr