PDB entry 5irl

View 5irl on RCSB PDB site
Description: crystal structure of rabbit nod2 ser mutant in an adp-bound state
Deposited on 2016-03-14, released 2016-06-29
The last revision was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: NOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1T469 (Start-829)
      • engineered mutation (752-753)
  • Heterogens: ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5irlA (A:)
    gpefeaaackkymsklrtivaaqsrflstydgaenlclediytentlevrtevgmagplh
    kspaalgleelfspnghlnedadtvlvvgeagsgkstllqqvhllwatgqdfqeflfvfp
    fscrqlqcvarplsvmtllfehccwpdvgqqdvfqflldhpdrilltfdgfdefkfkftd
    herhcsptdptsvqtllfnllqgnllknarkvltsrpdavsaflrkyvrtefnlkgfsee
    gielylrkchrepgvadrlihllqttsalhglchlpvfswmvskchqelllqdggspktt
    tdmyllilqhflrhaslpdsasqglgpsllqgrlptllrlgqlalwglgmccyvfsaqql
    qaaqvdpddislgflvqaqgvvpgstapleflhitfqcflaafylvlstdvptaslrylf
    ncrrpgssplsrllprlcvqgsehkestvaallqktephnlqitaaflagllsrehrdll
    aacqasersllrrracarwclarslhkhfrsippavpgeaksmhampgflwlirslyemq
    eerlaqeavrglnvehlkltfcgvgpaecaalafvlrhlrrpvalqldhnsvgdigveql
    lpclgackalylrdnnisdrgickliehalhceqlqklalfnnkltdgcahsvaqllack
    qnflalrlgnnhitaegaqvlaeglrdnsslqflgfwgnkvgdkgaqalaealsdhqslk
    wlslvgnnigsvgaqalasmleknvaleelclaanhlqdagvcslaeglkrnsslkvlkl
    snncitfvgaeallqalasndtilevwlrgnpfspeemealshrdsrlll
    

    Sequence, based on observed residues (ATOM records):
    >5irlA (A:)
    eaaackkymsklrtivaaqsrflnlclediytentlevrtaalgleelfsdadtvlvvge
    agsgkstllqqvhllwatgqdfqeflfvfpfscrqlqcvarplsvmtllfehccwpdvgq
    qdvfqflldhpdrilltfdgfdefkfkftdherhcsptdptsvqtllfnllqgnllknar
    kvltsrpdavsaflrkyvrtefnlkgfseegielylrkchrepgvadrlihllqttsalh
    glchlpvfswmvskchqelllqdggspktttdmyllilqhflrhasllqgrlptllrlgq
    lalwglgmccyvfsaqqlqaaqvdpddislgflvqapleflhitfqcflaafylvlstdv
    ptaslrylfncstvaallqktephnlqitaaflagllsrehrdllaacqasersllrrra
    carwclarslhkhfrsipampgflwlirslyemqeerlaqeavrglnvehlkltfcgvgp
    aecaalafvlrhlrrpvalqldhnsvgdigveqllpclgackalylrdnnisdrgickli
    ehalhceqlqklalfnnkltdgcahsvaqllackqnflalrlgnnhitaegaqvlaeglr
    dnsslqflgfwgnkvgdkgaqalaealsdhqslkwlslvgnnigsvgaqalasmleknva
    leelclaanhlqdagvcslaeglkrnsslkvlklsnncitfvgaeallqalasndtilev
    wlrgnpfspeemealshrdsrlll