PDB entry 5ira

View 5ira on RCSB PDB site
Description: Expanding Nature's Catalytic Repertoire -Directed Evolution of an Artificial Metalloenzyme for In Vivo Metathesis
Class: biotin-binding protein
Keywords: biotin-binding protein, beta barrel, metathesis, organometallic complex
Deposited on 2016-03-12, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Artificial Metathesase
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IRA
    Domains in SCOPe 2.06: d5iraa1, d5iraa2
  • Heterogens: 9RU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5iraA (A:)
masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
kstlvghdtftkvkpsaasidaakkagvnngnpldavqq

    Sequence, based on observed residues (ATOM records): (download) 
    >5iraA (A:)
deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vk