PDB entry 5iqy

View 5iqy on RCSB PDB site
Description: Structure of apo-Dehydroascorbate Reductase from Pennisetum Glaucum phased by Iodide-SAD method
Class: oxidoreductase
Keywords: Dehydroascorbate Reductase, Iodide-SAD method, OXIDOREDUCTASE
Deposited on 2016-03-11, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehydroascorbate reductase
    Species: Pennisetum americanum [TaxId:4543]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqya1, d5iqya2
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iqyA (A:)
    gshmavevcvkaavgapdilgdcpfsqrvlltleekkityemklvdlsnkpewflkispe
    gkvpvfnsgdgkwiadsdvitqvieekfptpslvtppeyasvgskifpsfvkflkskdas
    dgsekalldelqaldehlkahgpyisgenvsaadlslgpklfhlqvalehfkgwkipenl
    tsvhaytkalfsresfvktkpanqyliagwapkvna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqyA (A:)
    vevcvkaavgapdilgdcpfsqrvlltleekkityemklvdlsnkpewflkispegkvpv
    fnsgdgkwiadsdvitqvieekfptpslvtppeyasvgskifpsfvkflkskdasdgsek
    alldelqaldehlkahgpyisgenvsaadlslgpklfhlqvalehfkgwkipenltsvha
    ytkalfsresfvktkpanqyliagwapkvna