PDB entry 5iqs

View 5iqs on RCSB PDB site
Description: welo5 bound to fe(ii), cl, and 2-oxoglutarate
Deposited on 2016-03-11, released 2016-06-29
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WelO5
    Species: Hapalosiphon welwitschii UTEX B 1830 [TaxId:1433842]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: WelO5
    Species: Hapalosiphon welwitschii UTEX B 1830 [TaxId:1433842]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: WelO5
    Species: Hapalosiphon welwitschii UTEX B 1830 [TaxId:1433842]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, AKG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iqsA (A:)
    mkhhhhhhhsdydipttenlyfqgsmsnntvstkpalhfldinatevkkyptaiqdiiin
    rsfdgmiirgvfprdtmeqvarcleegndggmksilnkneefgtkvaqiyghaivgqspd
    lkdyfassaifrqacrtmfqgspdfeeqvesifhslsglpveiptgpegqtytpatirll
    legreiavhvgndfllmpaanhlktlldlsdqlsyfipltvpeaggelvvyslewnpqea
    skyaqmqeymddvefkiksnqsqsvayapgpgdmllfnggryyhrvsevignsprrtigg
    flafskqrdkiyyws
    

    Sequence, based on observed residues (ATOM records):
    >5iqsA (A:)
    alhfldinatevkkyptaiqdiiinrsfdgmiirgvfprdtmeqvarcleegndggmksi
    lnkneefgtkvaqiyghaivgqspdlkdyfassaifrqacrtmfqgspdfeeqvesifhs
    lsglpveiptgpegqtytpatirlllegreiavhvgndfllmpaanhlktlldlsdqlsy
    fipltvpeaggelvvyslewnpqeaskyaqmqeymddvefkiksnqsqsvayapgpgdml
    lfnggryyhrvsevignsprrtiggflafskqrdkiyyws
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iqsB (B:)
    mkhhhhhhhsdydipttenlyfqgsmsnntvstkpalhfldinatevkkyptaiqdiiin
    rsfdgmiirgvfprdtmeqvarcleegndggmksilnkneefgtkvaqiyghaivgqspd
    lkdyfassaifrqacrtmfqgspdfeeqvesifhslsglpveiptgpegqtytpatirll
    legreiavhvgndfllmpaanhlktlldlsdqlsyfipltvpeaggelvvyslewnpqea
    skyaqmqeymddvefkiksnqsqsvayapgpgdmllfnggryyhrvsevignsprrtigg
    flafskqrdkiyyws
    

    Sequence, based on observed residues (ATOM records):
    >5iqsB (B:)
    palhfldinatevkkyptaiqdiiinrsfdgmiirgvfprdtmeqvarcleegndggmks
    ilnkneefgtkvaqiyghaivgqspdlkdyfassaifrqacrtmfqgspdfeeqvesifh
    slsglpveiptgpegqtytpatirlllegreiavhvgndfllmpaanhlktlldlsdqls
    yfipltvpeaggelvvyslewnpqeaskyaqmqeymddvefkiksnqsqsvayapgpgdm
    llfnggryyhrvsevignsprrtiggflafskqrdkiyyws
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5iqsC (C:)
    mkhhhhhhhsdydipttenlyfqgsmsnntvstkpalhfldinatevkkyptaiqdiiin
    rsfdgmiirgvfprdtmeqvarcleegndggmksilnkneefgtkvaqiyghaivgqspd
    lkdyfassaifrqacrtmfqgspdfeeqvesifhslsglpveiptgpegqtytpatirll
    legreiavhvgndfllmpaanhlktlldlsdqlsyfipltvpeaggelvvyslewnpqea
    skyaqmqeymddvefkiksnqsqsvayapgpgdmllfnggryyhrvsevignsprrtigg
    flafskqrdkiyyws
    

    Sequence, based on observed residues (ATOM records):
    >5iqsC (C:)
    alhfldinatevkkyptaiqdiiinrsfdgmiirgvfprdtmeqvarcleegndggmksi
    lnkneefgtkvaqiyghaivgqspdlkdyfassaifrqacrtmfqgspdfeeqvesifhs
    lsglpveiptgpegqtytpatirlllegreiavhvgndfllmpaanhlktlldlsdqlsy
    fipltvpeaggelvvyslewnpqeaskyaqmqeymddvefkiksnqsqsvayapgpgdml
    lfnggryyhrvsevignsprrtiggflafskqrdkiyyws