PDB entry 5iqn

View 5iqn on RCSB PDB site
Description: crystal structure of the e. coli type 1 pilus subunit fimg (engineered variant with substitution q134e; n-terminal fimg residues 1-12 truncated) in complex with the donor strand peptide dsf_sririrgyvr
Deposited on 2016-03-11, released 2016-07-06
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein fimG
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: fimG, b4319, JW4282
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08190 (0-131)
      • engineered mutation (121)
  • Chain 'B':
    Compound: Protein fimF
    Species: ESCHERICHIA COLI K-12, synthetic [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-9)
      • engineered mutation (1)
      • engineered mutation (3)
  • Chain 'F':
    Compound: Protein fimF
    Species: ESCHERICHIA COLI K-12, synthetic [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-9)
      • engineered mutation (1)
      • engineered mutation (3)
  • Chain 'G':
    Compound: Protein fimG
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: fimG, b4319, JW4282
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08190 (0-131)
      • engineered mutation (121)
  • Heterogens: CO, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5iqnA (A:)
    akpctvsttnatvdlgdlysfslmsagaasawhdvaleltncpvgtsrvtasfsgaadst
    gyyknqgtaqniqlelqddsgntlntgatktvqvddssqsahfplqvraltvnggatqgt
    ieavisitytys
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5iqnB (B:)
    sririrgyvr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5iqnF (F:)
    sririrgyvr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >5iqnG (G:)
    akpctvsttnatvdlgdlysfslmsagaasawhdvaleltncpvgtsrvtasfsgaadst
    gyyknqgtaqniqlelqddsgntlntgatktvqvddssqsahfplqvraltvnggatqgt
    ieavisitytys