PDB entry 5iqk

View 5iqk on RCSB PDB site
Description: Rm3 metallo-beta-lactamase
Class: hydrolase
Keywords: lactamase, metallo, metagenomic, antibiotic resistance, HYDROLASE
Deposited on 2016-03-10, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase Rm3
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IQK
    Domains in SCOPe 2.07: d5iqka_
  • Chain 'B':
    Compound: beta-lactamase Rm3
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IQK (0-End)
    Domains in SCOPe 2.07: d5iqkb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iqkA (A:)
    tpgcevcatwnadqapfrlfgntyyvgmkglssvlvtspqghvlidgglpesapkiiani
    galgfriedvklilnshghidhagglaelqrrsnalvaaspsaaldlasgevgpddpqyh
    alpkyppvkdmrlardggqfnvgpvyltahatpghtpgglswtwqscdgprclnmvyads
    inavsrpgfkfsasseypnaladlrhsfetleklpcdvlisahpeasqlwqrleasatgg
    sdafvdpqacrayvaaartlldsrldqekqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqkA (A:)
    pgcevcatwnadqapfrlfgntyyvgmkglssvlvtspqghvlidgglpesapkiianig
    algfriedvklilnshghidhagglaelqrrsnalvaaspsaaldlasgevgpddpqyha
    lpkyppvkdmrlardggqfnvgpvyltahatpghtpgglswtwqscdgprclnmvyadsi
    navsrpgfkfsasseypnaladlrhsfetleklpcdvlisahpeasqlwqrleasatggs
    dafvdpqacrayvaaartlldsrldqekq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iqkB (B:)
    tpgcevcatwnadqapfrlfgntyyvgmkglssvlvtspqghvlidgglpesapkiiani
    galgfriedvklilnshghidhagglaelqrrsnalvaaspsaaldlasgevgpddpqyh
    alpkyppvkdmrlardggqfnvgpvyltahatpghtpgglswtwqscdgprclnmvyads
    inavsrpgfkfsasseypnaladlrhsfetleklpcdvlisahpeasqlwqrleasatgg
    sdafvdpqacrayvaaartlldsrldqekqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqkB (B:)
    tpgcevcatwnadqapfrlfgntyyvgmkglssvlvtspqghvlidgglpesapkiiani
    galgfriedvklilnshghidhagglaelqrrsnalvaaspsaaldlasgevgpddpqyh
    alpkyppvkdmrlardggqfnvgpvyltahatpghtpgglswtwqscdgprclnmvyads
    inavsrpgfkfsasseypnaladlrhsfetleklpcdvlisahpeasqlwqrleasatgg
    sdafvdpqacrayvaaartlldsrldqekq