PDB entry 5iqi

View 5iqi on RCSB PDB site
Description: aminoglycoside phosphotransferase (2'')-ia (ctd of aac(6')- ie/aph(2'')-ia) y237f mutant in complex with gmppnp and magnesium
Deposited on 2016-03-10, released 2016-05-25
The last revision was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0C1 (Start-304)
      • engineered mutation (62)
  • Chain 'B':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0C1
      • engineered mutation (62)
  • Chain 'C':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0C1 (Start-304)
      • engineered mutation (62)
  • Chain 'D':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0C1
      • engineered mutation (62)
  • Heterogens: GNP, MG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iqiA (A:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgfakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqiA (A:)
    natnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkkkgfakek
    aiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllkrd
    iasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerlnat
    tvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigtnf
    gedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtykd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iqiB (B:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgfakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqiB (B:)
    yddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfsfakekaiy
    nflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllkrdias
    flrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerlnattvf
    egkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigtnfged
    ilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtyk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5iqiC (C:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgfakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqiC (C:)
    atnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkkkgfakeka
    iynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllkrdi
    asflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerlnatt
    vfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigtnfg
    edilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtykd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5iqiD (D:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgfakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqiD (D:)
    yddnatnvkamkyliehyfdnfkvdsieiigsvaylvnneyifktkfstfakekaiynfl
    ntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllkrdiasflr
    qmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerlnattvfegk
    kclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigtnfgedilr
    mygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtyk