PDB entry 5iqc

View 5iqc on RCSB PDB site
Description: aminoglycoside phosphotransferase (2'')-ia (ctd of aac(6')- ie/aph(2'')-ia) in complex with gmppnp, magnesium, and gentamicin c1
Deposited on 2016-03-10, released 2016-05-25
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aacA-aphD, R015, VRA0030
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, 51G, MG, CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iqcA (A:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgyakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqcA (A:)
    yddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkkkgya
    kekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnll
    krdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerl
    nattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeig
    tnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtyk
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iqcB (B:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgyakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqcB (B:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfsgyak
    ekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllk
    rdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerln
    attvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigt
    nfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtyk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5iqcC (C:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgyakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqcC (C:)
    atnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkkkgyakeka
    iynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllkrdi
    asflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerlnatt
    vfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigtnfg
    edilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrtykd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5iqcD (D:)
    meyryddnatnvkamkyliehyfdnfkvdsieiigsgydsvaylvnneyifktkfstnkk
    kgyakekaiynflntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseee
    qnllkrdiasflrqmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesf
    merlnattvfegkkclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledse
    eeigtnfgedilrmygnidiekakeyqdiveeyypietivygiknikqefiengrkeiyk
    rtykd
    

    Sequence, based on observed residues (ATOM records):
    >5iqcD (D:)
    yddnatnvkamkyliehyfdnfkvdsieiigdsvaylvnneyifktkfsyakekaiynfl
    ntnletnvkipnieysyisdelsilgykeikgtfltpeiystmseeeqnllkrdiasflr
    qmhgldytdisectidnkqnvleeyillretiyndltdiekdyiesfmerlnattvfegk
    kclchndfscnhllldgnnrltgiidfgdsgiideycdfiylledseeeigtnfgedilr
    mygnidiekakeyqdiveeyypietivygiknikqefiengrkeiykrty