PDB entry 5iq7

View 5iq7 on RCSB PDB site
Description: crystal structure of 10e8-s74w fab in complex with an hiv-1 gp41 peptide.
Deposited on 2016-03-10, released 2016-04-20
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 3.29 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 10E8-S74W Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 5IQ7 (0-130)
    • Uniprot P01857 (131-232)
  • Chain 'L':
    Compound: 10E8-S74W Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLC2
    Database cross-references and differences (RAF-indexed):
    • PDB 5IQ7 (0-115)
    • Uniprot P0CG05 (116-211)
  • Chain 'P':
    Compound: gp41 MPER peptide
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot V9QIE5 (Start-30)
      • expression tag (31)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5iq7H (H:)
    evqlvesggglvkpggslrlscsasgfdfdnawmtwvrqppgkglewvgritgpgegwsv
    dyaapvegrftisrlnwinflylemnnlrmedsglyfcartgkyydfwsgyppgeeyfqd
    wgrgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >5iq7L (L:)
    yeltqetgvsvalgrtvtitcrgdslrshyaswyqkkpgqapillfygknnrpsgvpdrf
    sgsasgnrasltisgaqaeddaeyycssrdksgsrlsvfgggtkltvlsqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5iq7P (P:)
    rrrneqelleldkwaslwnwfditnwlwyirrrr
    

    Sequence, based on observed residues (ATOM records):
    >5iq7P (P:)
    neqelleldkwaslwnwfditnwlwyirr