PDB entry 5iq5

View 5iq5 on RCSB PDB site
Description: nmr solution structure of mayaro virus macro domain
Deposited on 2016-03-10, released 2017-12-20
The last revision was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macro domain
    Species: Mayaro virus (strain Brazil) [TaxId:374990]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8QZ73 (1-159)
      • conflict (5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iq5A (A:)
    mapaytvkradiataiedavvnaanhrgqvgdgvcravarkwpqafrnaatpvgtaktvk
    cdetyiihavgpnfnntseaegdrdlaaayravaaeinrlsissvaipllstgifsagkd
    rvhqslshllaamdttearvtiycrdktweqkiktvlqnrhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iq5A (A:)
    apaytvkradiataiedavvnaanhrgqvgdgvcravarkwpqafrnaatpvgtaktvkc
    detyiihavgpnfnntseaegdrdlaaayravaaeinrlsissvaipllstgifsagkdr
    vhqslshllaamdttearvtiycrdktweqkiktvlqnr