PDB entry 5iq4

View 5iq4 on RCSB PDB site
Description: crystal structure of rntmm mutant y207s soaking
Deposited on 2016-03-10, released 2017-01-18
The last revision was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavin-containing monooxygenase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_08155
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SLM3
      • engineered mutation (206)
  • Chain 'B':
    Compound: Flavin-containing monooxygenase
    Species: Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM) [TaxId:89187]
    Gene: ISM_08155
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SLM3
      • engineered mutation (206)
  • Heterogens: NAP, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iq4A (A:)
    mtkrvavigagpsglaqlrafqsaadqgaeipeivcfekqanwgglwnytwrtgldenge
    pvhcsmyrylwsngpkeglefadysfeehfgkqiasyppravlfdyiegrvhkadvrkwi
    rfnspvrwvsydaetakftvtahnhetdstysedfdhvicasghfstpnvpfyegfdtfn
    grivhahdfrdarefegkdvlvmgasssaedigsqcwkygaksitscyrsapmgyawpdn
    weekpalekltgktahfadgstrdvdaiilctgykhffsflpddlrlktanrlatadlyk
    gvayvhnpamfylgmqdqwftfnmfdaqawwvrdailgritlpkdkaamladvaeretre
    easddvkyairyqadyvkelvaetdypsfdidgacdaffewkkhkakdimafrdnsyksv
    itgtmapvhhtpwkealddsmeaylqnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iq4A (A:)
    tkrvavigagpsglaqlrafqsaadqgaeipeivcfekqanwgglwnytwrtgldengep
    vhcsmyrylwsngpkeglefadysfeehfgkqiasyppravlfdyiegrvhkadvrkwir
    fnspvrwvsydaetakftvtahnhetdstysedfdhvicasghfstpnvpfyegfdtfng
    rivhahdfrdarefegkdvlvmgasssaedigsqcwkygaksitscyrsapmgyawpdnw
    eekpalekltgktahfadgstrdvdaiilctgykhffsflpddlrlktanrlatadlykg
    vayvhnpamfylgmqdqwftfnmfdaqawwvrdailgritlpkdkaamladvaeretree
    asddvkyairyqadyvkelvaetdypsfdidgacdaffewkkhkakdimafrdnsyksvi
    tgtmapvhhtpwkealddsmeaylq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iq4B (B:)
    mtkrvavigagpsglaqlrafqsaadqgaeipeivcfekqanwgglwnytwrtgldenge
    pvhcsmyrylwsngpkeglefadysfeehfgkqiasyppravlfdyiegrvhkadvrkwi
    rfnspvrwvsydaetakftvtahnhetdstysedfdhvicasghfstpnvpfyegfdtfn
    grivhahdfrdarefegkdvlvmgasssaedigsqcwkygaksitscyrsapmgyawpdn
    weekpalekltgktahfadgstrdvdaiilctgykhffsflpddlrlktanrlatadlyk
    gvayvhnpamfylgmqdqwftfnmfdaqawwvrdailgritlpkdkaamladvaeretre
    easddvkyairyqadyvkelvaetdypsfdidgacdaffewkkhkakdimafrdnsyksv
    itgtmapvhhtpwkealddsmeaylqnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iq4B (B:)
    tkrvavigagpsglaqlrafqsaadqgaeipeivcfekqanwgglwnytwrtgldengep
    vhcsmyrylwsngpkeglefadysfeehfgkqiasyppravlfdyiegrvhkadvrkwir
    fnspvrwvsydaetakftvtahnhetdstysedfdhvicasghfstpnvpfyegfdtfng
    rivhahdfrdarefegkdvlvmgasssaedigsqcwkygaksitscyrsapmgyawpdnw
    eekpalekltgktahfadgstrdvdaiilctgykhffsflpddlrlktanrlatadlykg
    vayvhnpamfylgmqdqwftfnmfdaqawwvrdailgritlpkdkaamladvaeretree
    asddvkyairyqadyvkelvaetdypsfdidgacdaffewkkhkakdimafrdnsyksvi
    tgtmapvhhtpwkealddsmeaylq