PDB entry 5ipo

View 5ipo on RCSB PDB site
Description: solution structure of hge36: scorpine-like peptide from hadrurus gertschi
Deposited on 2016-03-09, released 2016-06-29
The last revision was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hge-scorpine
    Species: Hadrurus gertschi [TaxId:380989]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ipoA (A:)
    vhkmaknqfgcfanvdvkgdckrhckaedkegichgtkckcgvpisyl