PDB entry 5ip4

View 5ip4 on RCSB PDB site
Description: x-ray structure of the c-terminal domain of human doublecortin
Class: transferase
Keywords: dcx domain, ubiquitin-like fold, microtubule associated, signaling protein, transferase
Deposited on 2016-03-09, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xa4551 nanobody against c-dcx
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IP4
    Domains in SCOPe 2.07: d5ip4a1, d5ip4a2
  • Chain 'B':
    Compound: xa4551 nanobody against c-dcx
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IP4
    Domains in SCOPe 2.07: d5ip4b1, d5ip4b2
  • Chain 'D':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ip4A (A:)
    qvqlqesggglvqaggslrlsctasvniiggnhwawyrqapgqqrdlvaslsrynanyad
    svkgrftisrdnaknaaylqmnslkpedtaiyfcalenyywgqgtqvtvsshhhhhhepe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ip4A (A:)
    vqlqesggglvqaggslrlsctasvniiggnhwawyrqapgqqrdlvaslsrynanyads
    vkgrftisrdnaknaaylqmnslkpedtaiyfcalenyywgqgtqvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ip4B (B:)
    qvqlqesggglvqaggslrlsctasvniiggnhwawyrqapgqqrdlvaslsrynanyad
    svkgrftisrdnaknaaylqmnslkpedtaiyfcalenyywgqgtqvtvsshhhhhhepe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ip4B (B:)
    vqlqesggglvqaggslrlsctasvniiggnhwawyrqapgqqrdlvaslsrynanyads
    vkgrftisrdnaknaaylqmnslkpedtaiyfcalenyywgqgtqvtvss
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.