PDB entry 5ip3

View 5ip3 on RCSB PDB site
Description: tomato spotted wilt tospovirus nucleocapsid protein-ssdna complex
Deposited on 2016-03-09, released 2017-03-22
The last revision was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Tomato spotted wilt virus [TaxId:11613]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nucleoprotein
    Species: Tomato spotted wilt virus [TaxId:11613]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: nucleoprotein
    Species: Tomato spotted wilt virus [TaxId:11613]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA (5'-d(p*tp*tp*tp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA (5'-d(p*tp*tp*tp*tp*tp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(p*tp*tp*tp*tp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ip3A (A:)
    mnhkhhhhhhssgenlyfqghmskvkltkenivalltqgkdlefeenqnlvafnfktfcl
    enldqikkmsiiscltflknrqsimkvikqsdftfgkitikktsdrigatdmtfrrldsl
    irvrlveetgnsenlntikskiashpliqayglplddaksvrlaimlggslpliasvdsf
    emisvvlaiyqdakykdlgidpkkydtkealgkvctvlkskafemnedqvkkgkeyaail
    sssnpnakgsvamehysetlnkfyemfgvkkqaklaela
    

    Sequence, based on observed residues (ATOM records):
    >5ip3A (A:)
    kvkltkenivalltqgkdlefeenvafnfktfclenldqikkmsiiscltflknrqsimk
    vikqsdftfgkitidrigatdmtfrrldslirvrlveetgnsenlntikskiashpliqa
    yglplddaksvrlaimlggslpliasvdsfemisvvlaiyqdakykdlgidpkkydtkea
    lgkvctvlkskafemnedqvkkgkeyaailsssnpnakgsvamehysetlnkfyemfgvk
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ip3B (B:)
    mnhkhhhhhhssgenlyfqghmskvkltkenivalltqgkdlefeenqnlvafnfktfcl
    enldqikkmsiiscltflknrqsimkvikqsdftfgkitikktsdrigatdmtfrrldsl
    irvrlveetgnsenlntikskiashpliqayglplddaksvrlaimlggslpliasvdsf
    emisvvlaiyqdakykdlgidpkkydtkealgkvctvlkskafemnedqvkkgkeyaail
    sssnpnakgsvamehysetlnkfyemfgvkkqaklaela
    

    Sequence, based on observed residues (ATOM records):
    >5ip3B (B:)
    vkltkenivalltqgkdlefenlvafnfktfclenldqikkmsiiscltflknrqsimkv
    ikqsdftfgkitikktsdrigatdmtfrrldslirvrlveetgnsenlntikskiashpl
    iqayglplddaksvrlaimlggslpliasvdsfemisvvlaiyqdakykdlgidpkkydt
    kealgkvctvlkskafemnedqvkkgkeyaailsssnpnakgsvamehysetlnkfyemf
    gvkkqa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ip3C (C:)
    mnhkhhhhhhssgenlyfqghmskvkltkenivalltqgkdlefeenqnlvafnfktfcl
    enldqikkmsiiscltflknrqsimkvikqsdftfgkitikktsdrigatdmtfrrldsl
    irvrlveetgnsenlntikskiashpliqayglplddaksvrlaimlggslpliasvdsf
    emisvvlaiyqdakykdlgidpkkydtkealgkvctvlkskafemnedqvkkgkeyaail
    sssnpnakgsvamehysetlnkfyemfgvkkqaklaela
    

    Sequence, based on observed residues (ATOM records):
    >5ip3C (C:)
    skvkltkenivalltqgkdlefeenfktfclenldqikkmsiiscltflknrqsimkvik
    qsdftfgkitikkrigatdmtfrrldslirvrlveetgnsenlntikskiashpliqayg
    lplddaksvrlaimlggslpliasvdsfemisvvlaiyqdakykdlgidpkkydtkealg
    kvctvlkskafemnedqvkkgkeyaailsssnpnakgsvamehysetlnkfyemfgvkkq
    aklael
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.