PDB entry 5iov

View 5iov on RCSB PDB site
Description: cryo-em structure of glun1/glun2b nmda receptor in the glutamate/glycine/ro25-6981-bound conformation
Deposited on 2016-03-09, released 2016-04-20
The last revision was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: EM
Resolution: 7.5 Å
R-factor: N/A
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-methyl-D-aspartate receptor subunit NR1-8a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0KD18 (0-End)
      • engineered mutation (28-29)
      • engineered mutation (277)
      • engineered mutation (327)
      • engineered mutation (345)
      • engineered mutation (417)
      • engineered mutation (446)
      • engineered mutation (470-472)
      • engineered mutation (579)
      • engineered mutation (586)
      • engineered mutation (625)
      • engineered mutation (738)
  • Chain 'B':
    Compound: Ionotropic glutamate receptor subunit NR2B
    Species: Xenopus laevis [TaxId:8355]
    Gene: NR2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7XY94 (Start-824)
      • engineered mutation (63)
      • engineered mutation (68)
      • engineered mutation (342)
      • engineered mutation (485)
      • engineered mutation (600)
      • engineered mutation (639-640)
  • Chain 'C':
    Compound: N-methyl-D-aspartate receptor subunit NR1-8a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0KD18 (0-End)
      • engineered mutation (28-29)
      • engineered mutation (277)
      • engineered mutation (327)
      • engineered mutation (345)
      • engineered mutation (417)
      • engineered mutation (446)
      • engineered mutation (470-472)
      • engineered mutation (579)
      • engineered mutation (586)
      • engineered mutation (625)
      • engineered mutation (738)
  • Chain 'D':
    Compound: Ionotropic glutamate receptor subunit NR2B
    Species: Xenopus laevis [TaxId:8355]
    Gene: NR2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7XY94 (Start-824)
      • engineered mutation (63)
      • engineered mutation (68)
      • engineered mutation (342)
      • engineered mutation (485)
      • engineered mutation (600)
      • engineered mutation (639-640)
  • Heterogens: GLY, QEM, GLU

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iovA (A:)
    dpkivnigavlstkkheqifreavnqanffhftrkiqlnatsvthrpnaiqmalsvcedl
    issqvyailvshppaptdhltptpisytagfyripviglttrmsiysdksihlsflrtvp
    pyshqalvwfemmrlfnwnhvilivsddhegraaqkkletlleekeskadkvlqfepgtk
    nltallleakelearviilsaseddatavyksaamldmtgagyvwlvgereisgsalrya
    pdgiiglqlingknesahisdavavvaqaihelfemeqitdpprgcvgntniwktgplfk
    rvlmsskypdgvtgriefnedgdrkfaqysimnlqnrklvqvgifdgsyiiqndrkiiwp
    ggeterpqgyqmstrlkivtihqepfvyvrpttsdgtcreeytingdpikkvicngpdet
    ipgrptvpqccygfcvdlliklaremdftyevhlvadgkfgtqervnnsnaaawngmmge
    llsgqadmivapltinneraqyiefskpfkyqgltilvkkeiprstldsfmqpfqstlwl
    lvglsvhvvavmlylldrfspfgrfedaltlssamwfswrvllnsglgegaprsfsaril
    gmvwagfamiivasytanlaaflvlrrpeeritgindprlrnpsdkfiyatvkqssvdiy
    frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
    ffrsgfgigmrkdspwkqevslnilkshengfmeeldktwvryqecdsrsnapatltfen
    magvfmlvaggivagiflifieiayksraeakrmkglevlfq
    

    Sequence, based on observed residues (ATOM records):
    >5iovA (A:)
    dpkivnigavlstkkheqifreavnqanffhftrkiqlnatsvthrpnaiqmalsvcedl
    issqvyailvshppaptdhltptpisytagfyrpviglttrmsiysdksihlsflrtvpp
    yshqalvwfemmrlfnwnhvilivsddhegraaqkkletlleekeskadkvlqfepgtkn
    ltallleakelearviilsaseddatavyksaamldmtgagyvwlvgereisgsalryap
    dgiiglqlingknesahisdavavvaqaihelfemeqitdpprgcvgntniwktgplfkr
    vlmsskypdgvtgriefnedgdrkfaqysimnlqnrklvqvgifdgsyiiqndrkiiwpg
    geterpqgyqmstrlkivtihqepfvyvrpttsdgtcreeytingdpikkvicngpdeti
    pgrptvpqccygfcvdlliklaremdftyevhlvadgkfgtqervnnsnaaawngmmgel
    lsgqadmivapltinneraqyiefskpfkyqgltilvkkeiprstldsfmqpfqstlwll
    vglsvhvvavmlylldrfspfgrfedaltlssamwfswrvllnsglgegaprsfsarilg
    mvwagfamiivasytanlaaflvlrrpeeritgindprlrnpsdkfiyatvkqssvdiyf
    rrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelf
    frsgfgigmrkdspwkqevslnilkshengfmeeldktwvryqecdsrsnapatltfenm
    agvfmlvaggivagiflifieia
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5iovB (B:)
    mrpteaccylkisliilfysrayaqkhpnmdiavilvgtteevaikdvhekddfhhlpvt
    prvelvtmqesdpksiitricdlmsdkkvqgvvfgddtdqeaiaqildfisvqtltpilg
    ihggssmimadkeeasmffqfgpsieqqasvmlnimeeydwyifsivttyfpgyqdfenk
    vrstiensfvgweleevihldmslddidskiqnqlkklqspvillyctkeeatyifevah
    svgltgygftwivpslvagdtdtvpdefptglisvsydewdydlparvrdgiaiittaas
    tmlsehnsipqsksscnniqesrvyeahmlkrylinvtfegrdlsfsedgyqmhpklvii
    llnqerkwervgkykdrslkmwpvfdlypnseehkdehlsivtleeapfvivedvdplsg
    tcmrntvpcrkqirpenrteeggnyikrcckgfcidilkkiaktvkftydlylvtngkhg
    kkingvwngmigevvtkraymavgsltineersevvdfsvpfietgisvmvsrsngtvsp
    saflepfsadvwvmmfvmllivsavavfvfeyfspvgyngpsftigkaiwllwglvfnns
    lpvqnpkgttskimvsvwaffaviflasytanlaafmiqrryvdqvsglsdkkfqrpndf
    spafrfgtvpngsternirnnylemhsymvkfnqrsvqdallslksgkldafiydaavln
    ymagrdegcklvtigsgkvfattgygiaiqkdsgwkrqvdlailqlfgdgemeelealwl
    tgichneknevmssqldidnmagvfymlaaamalslitfimehlf
    

    Sequence, based on observed residues (ATOM records):
    >5iovB (B:)
    pnmdiavilvgtteevaikdvhekddfhhlpvtprvelvtmqesdpksiitricdlmsdk
    kvqgvvfgddtdqeaiaqildfisvqtltpilgihggssmimadkeeasmffqfgpsieq
    qasvmlnimeeydwyifsivttyfpgyqdfenkvrstiensfvgweleevihldmslddi
    dskiqnqlkklqspvillyctkeeatyifevahsvgltgygftwivpslvagdtdtvpde
    fptglisvsydewdydlparvrdgiaiittaastmlsehnsipqsksscnniqesrvyea
    hmlkrylinvtfegrdlsfsedgyqmhpklviillnqerkwervgkykdrslkmwpvfdl
    ypnseehkdehlsivtleeapfvivedvdplsgtcmrntvpcrkqirpenrteeggnyik
    rcckgfcidilkkiaktvkftydlylvtngkhgkkingvwngmigevvtkraymavgslt
    ineersevvdfsvpfietgisvmvsrsngtvspsaflepfsadvwvmmfvmllivsavav
    fvfeyfspvgyngpsftigkaiwllwglvfnnslpvqnpkgttskimvsvwaffavifla
    sytanlaafmiqrryvdqvsglsdkkfqrpndfspafrfgtvpngsternirnnylemhs
    ymvkfnqrsvqdallslksgkldafiydaavlnymagrdegcklvtigsgkvfattgygi
    aiqkdsgwkrqvdlailqlfgdgemeelealwltgichneknevmssqldidnmagvfym
    laaamalslitfimehlf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5iovC (C:)
    dpkivnigavlstkkheqifreavnqanffhftrkiqlnatsvthrpnaiqmalsvcedl
    issqvyailvshppaptdhltptpisytagfyripviglttrmsiysdksihlsflrtvp
    pyshqalvwfemmrlfnwnhvilivsddhegraaqkkletlleekeskadkvlqfepgtk
    nltallleakelearviilsaseddatavyksaamldmtgagyvwlvgereisgsalrya
    pdgiiglqlingknesahisdavavvaqaihelfemeqitdpprgcvgntniwktgplfk
    rvlmsskypdgvtgriefnedgdrkfaqysimnlqnrklvqvgifdgsyiiqndrkiiwp
    ggeterpqgyqmstrlkivtihqepfvyvrpttsdgtcreeytingdpikkvicngpdet
    ipgrptvpqccygfcvdlliklaremdftyevhlvadgkfgtqervnnsnaaawngmmge
    llsgqadmivapltinneraqyiefskpfkyqgltilvkkeiprstldsfmqpfqstlwl
    lvglsvhvvavmlylldrfspfgrfedaltlssamwfswrvllnsglgegaprsfsaril
    gmvwagfamiivasytanlaaflvlrrpeeritgindprlrnpsdkfiyatvkqssvdiy
    frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
    ffrsgfgigmrkdspwkqevslnilkshengfmeeldktwvryqecdsrsnapatltfen
    magvfmlvaggivagiflifieiayksraeakrmkglevlfq
    

    Sequence, based on observed residues (ATOM records):
    >5iovC (C:)
    dpkivnigavlstkkheqifreavnqanffhftrkiqlnatsvthrpnaiqmalsvcedl
    issqvyailvshppaptdhltptpisytagfyrpviglttrmsiysdksihlsflrtvpp
    yshqalvwfemmrlfnwnhvilivsddhegraaqkkletlleekeskadkvlqfepgtkn
    ltallleakelearviilsaseddatavyksaamldmtgagyvwlvgereisgsalryap
    dgiiglqlingknesahisdavavvaqaihelfemeqitdpprgcvgntniwktgplfkr
    vlmsskypdgvtgriefnedgdrkfaqysimnlqnrklvqvgifdgsyiiqndrkiiwpg
    geterpqgyqmstrlkivtihqepfvyvrpttsdgtcreeytingdpikkvicngpdeti
    pgrptvpqccygfcvdlliklaremdftyevhlvadgkfgtqervnnsnaaawngmmgel
    lsgqadmivapltinneraqyiefskpfkyqgltilvkkeiprstldsfmqpfqstlwll
    vglsvhvvavmlylldrfspfgrfedaltlssamwfswrvllnsglgegaprsfsarilg
    mvwagfamiivasytanlaaflvlrrpeeritgindprlrnpsdkfiyatvkqssvdiyf
    rrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelf
    frsgfgigmrkdspwkqevslnilkshengfmeeldktwvryqecdsrsnapatltfenm
    agvfmlvaggivagiflifieia
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5iovD (D:)
    mrpteaccylkisliilfysrayaqkhpnmdiavilvgtteevaikdvhekddfhhlpvt
    prvelvtmqesdpksiitricdlmsdkkvqgvvfgddtdqeaiaqildfisvqtltpilg
    ihggssmimadkeeasmffqfgpsieqqasvmlnimeeydwyifsivttyfpgyqdfenk
    vrstiensfvgweleevihldmslddidskiqnqlkklqspvillyctkeeatyifevah
    svgltgygftwivpslvagdtdtvpdefptglisvsydewdydlparvrdgiaiittaas
    tmlsehnsipqsksscnniqesrvyeahmlkrylinvtfegrdlsfsedgyqmhpklvii
    llnqerkwervgkykdrslkmwpvfdlypnseehkdehlsivtleeapfvivedvdplsg
    tcmrntvpcrkqirpenrteeggnyikrcckgfcidilkkiaktvkftydlylvtngkhg
    kkingvwngmigevvtkraymavgsltineersevvdfsvpfietgisvmvsrsngtvsp
    saflepfsadvwvmmfvmllivsavavfvfeyfspvgyngpsftigkaiwllwglvfnns
    lpvqnpkgttskimvsvwaffaviflasytanlaafmiqrryvdqvsglsdkkfqrpndf
    spafrfgtvpngsternirnnylemhsymvkfnqrsvqdallslksgkldafiydaavln
    ymagrdegcklvtigsgkvfattgygiaiqkdsgwkrqvdlailqlfgdgemeelealwl
    tgichneknevmssqldidnmagvfymlaaamalslitfimehlf
    

    Sequence, based on observed residues (ATOM records):
    >5iovD (D:)
    pnmdiavilvgtteevaikdvhekddfhhlpvtprvelvtmqesdpksiitricdlmsdk
    kvqgvvfgddtdqeaiaqildfisvqtltpilgihggssmimadkeeasmffqfgpsieq
    qasvmlnimeeydwyifsivttyfpgyqdfenkvrstiensfvgweleevihldmslddi
    dskiqnqlkklqspvillyctkeeatyifevahsvgltgygftwivpslvagdtdtvpde
    fptglisvsydewdydlparvrdgiaiittaastmlsehnsipqsksscnniqesrvyea
    hmlkrylinvtfegrdlsfsedgyqmhpklviillnerkwervgkykdrslkmwpvfdly
    pnseehkdehlsivtleeapfvivedvdplsgtcmrntvpcrkqirpenrteeggnyikr
    cckgfcidilkkiaktvkftydlylvtngkhgkkingvwngmigevvtkraymavgslti
    neersevvdfsvpfietgisvmvsrsngtvspsaflepfsadvwvmmfvmllivsavavf
    vfeyfspvgyngpsftigkaiwllwglvfnnslpvqnpkgttskimvsvwaffaviflas
    ytanlaafmiqrryvdqvsglsdkkfqrpndfspafrfgtvpngsternirnnylemhsy
    mvkfnqrsvqdallslksgkldafiydaavlnymagrdegcklvtigsgkvfattgygia
    iqkdsgwkrqvdlailqlfgdgemeelealwltgichneknevmssqldidnmagvfyml
    aaamalslitfimehlf