PDB entry 5ioi

View 5ioi on RCSB PDB site
Description: x-ray structure of the n-terminal domain of human doublecortin
Class: transferase
Keywords: dcx domain, ubiquitin-like fold, microtubule associated, signaling protein, transferase
Deposited on 2016-03-08, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-106)
      • expression tag (0-7)
      • engineered mutation (90-91)
    Domains in SCOPe 2.07: d5ioia1, d5ioia2
  • Chain 'B':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-End)
      • engineered mutation (90-91)
    Domains in SCOPe 2.07: d5ioib_
  • Chain 'C':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-End)
      • engineered mutation (90-91)
    Domains in SCOPe 2.07: d5ioic_
  • Chain 'D':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-End)
      • expression tag (7)
      • engineered mutation (90-91)
    Domains in SCOPe 2.07: d5ioid1, d5ioid2
  • Chain 'E':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-106)
      • expression tag (0-7)
      • engineered mutation (90-91)
    Domains in SCOPe 2.07: d5ioie1, d5ioie2
  • Chain 'F':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-End)
      • engineered mutation (90-91)
    Domains in SCOPe 2.07: d5ioif_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ioiA (A:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ioiB (B:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ioiB (B:)
    akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
    kigsmdeleegesyvcssdnffddveyt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ioiC (C:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ioiC (C:)
    akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
    kigsmdeleegesyvcssdnffddveytknvnpnws
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ioiD (D:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ioiD (D:)
    makkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgs
    rkigsmdeleegesyvcssdnffddveyt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ioiE (E:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ioiF (F:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ioiF (F:)
    akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
    kigsmdeleegesyvcssdnffddveytknvnpnw