PDB entry 5ioh

View 5ioh on RCSB PDB site
Description: RepoMan-PP1a (protein phosphatase 1, alpha isoform) holoenzyme complex
Class: hydrolase/protein binding
Keywords: PP1 alpha; RepoMan, Ki-67; Phosphatase, HYDROLASE-PROTEIN BINDING complex
Deposited on 2016-03-08, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ioha_
  • Chain 'B':
    Compound: Cell division cycle-associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDCA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iohc_
  • Chain 'D':
    Compound: Cell division cycle-associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDCA2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iohA (A:)
    ghmgslnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplki
    cgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffll
    rgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlq
    smeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdl
    dlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iohA (A:)
    lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
    gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
    casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
    rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
    ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iohC (C:)
    ghmgslnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplki
    cgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffll
    rgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlq
    smeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdl
    dlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iohC (C:)
    lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
    gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
    casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
    rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
    ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

  • Chain 'D':
    No sequence available.