PDB entry 5io9

View 5io9 on RCSB PDB site
Description: x-ray structure of the n-terminal domain of human doublecortin
Class: transferase
Keywords: dcx domain, ubiquitin-like fold, microtubule associated, signaling protein, transferase
Deposited on 2016-03-08, released 2016-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-End)
      • expression tag (7)
      • engineered mutation (90-91)
    Domains in SCOPe 2.08: d5io9a1, d5io9a2
  • Chain 'B':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (8-105)
      • engineered mutation (90-91)
    Domains in SCOPe 2.08: d5io9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5io9A (A:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5io9A (A:)
    makkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgs
    rkigsmdeleegesyvcssdnffddveytknvnpnwsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5io9B (B:)
    lvprgshmakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvry
    iytidgsrkigsmdeleegesyvcssdnffddveytknvnpnwsvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5io9B (B:)
    akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsnlpqgvryiytidgsrkig
    smdeleegesyvcssdnffddveytknvnpnwsvn