PDB entry 5inw

View 5inw on RCSB PDB site
Description: structure of reaction loop cleaved lamprey angiotensinogen
Deposited on 2016-03-08, released 2016-10-05
The last revision was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative angiotensinogen
    Species: Lampetra fluviatilis [TaxId:7748]
    Gene: agt
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0MNC6
      • insertion (416)
  • Chain 'B':
    Compound: Putative angiotensinogen
    Species: Lampetra fluviatilis [TaxId:7748]
    Gene: agt
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0MNC6
      • insertion (416)
  • Chain 'C':
    Compound: C-terminal peptide of Putative angiotensinogen
    Species: Lampetra fluviatilis [TaxId:7748]
    Gene: agt
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: C-terminal peptide of Putative angiotensinogen
    Species: Lampetra fluviatilis [TaxId:7748]
    Gene: agt
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5inwA (A:)
    gerpymqpfhlippslsvqateqplasneawdypeplapgqspaasseegsseekgdere
    phgdegkrgrkdkkksktqriasavnglgfrlykqvlggagpadniffsplsiasalgvv
    tagangstraeldtalgfkeflhgkkkaksmkyfarlngalykrsagfelmgknvvfskk
    glwlyrqftrtvahlfksnvrsvdfgdsknavelmnayiekvtskkfpdvisdvdtdtsl
    vivnviyfkgswgnkfepdltknvrfwvnssysmmvptmhqraklsytqdrklrstvvkl
    pyeggasmlvivphrtedlpkveesvsqeqleewlsllgpsnhyvqlslpkfkisvsydl
    kaylsamgmssmfsygadlsritgmqklhvdkithksvlhvneegteakaetvvgimaap
    r
    

    Sequence, based on observed residues (ATOM records):
    >5inwA (A:)
    kksktqriasavnglgfrlykqvlggagpadniffsplsiasalgvvtagangstraeld
    talgfksmkyfarlngalykrsagfelmgknvvfskkglwlyrqftrtvahlfksnvrsv
    dfgdsknavelmnayiekvtskkfpdvisdvdtdtslvivnviyfkgswgnkfepdltkn
    vrfwvnssysmmvptmhqraklsytqdrklrstvvklpyeggasmlvivphrtedlpkve
    esvsqeqleewlsllgpsnhyvqlslpkfkisvsydlkaylsamgmssmfsygadlsrit
    gmqklhvdkithksvlhvneegteakaetvvgima
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5inwB (B:)
    gerpymqpfhlippslsvqateqplasneawdypeplapgqspaasseegsseekgdere
    phgdegkrgrkdkkksktqriasavnglgfrlykqvlggagpadniffsplsiasalgvv
    tagangstraeldtalgfkeflhgkkkaksmkyfarlngalykrsagfelmgknvvfskk
    glwlyrqftrtvahlfksnvrsvdfgdsknavelmnayiekvtskkfpdvisdvdtdtsl
    vivnviyfkgswgnkfepdltknvrfwvnssysmmvptmhqraklsytqdrklrstvvkl
    pyeggasmlvivphrtedlpkveesvsqeqleewlsllgpsnhyvqlslpkfkisvsydl
    kaylsamgmssmfsygadlsritgmqklhvdkithksvlhvneegteakaetvvgimaap
    r
    

    Sequence, based on observed residues (ATOM records):
    >5inwB (B:)
    sktqriasavnglgfrlykqvlggagpadniffsplsiasalgvvtagangstraeldta
    lgsmkyfarlngalykrsagfelmgknvvfskkglwlyrqftrtvahlfksnvrsvdfgd
    sknavelmnayiekvtskkfpdvisdvdtdtslvivnviyfkgswgnkfepdltknvrfw
    vnssysmmvptmhqraklsytqdrklrstvvklpyeggasmlvivphrtedlpkveesvs
    qeqleewlsllgpsnhyvqlslpkfkisvsydlkaylsamgmssmfsygadlsritgmqk
    lhvdkithksvlhvneegteakaetvvgima
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5inwC (C:)
    smpptvtvdrpfvvliydektravifmgrvadpkq
    

    Sequence, based on observed residues (ATOM records):
    >5inwC (C:)
    ptvtvdrpfvvliydektravifmgrvadpk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5inwD (D:)
    smpptvtvdrpfvvliydektravifmgrvadpkq
    

    Sequence, based on observed residues (ATOM records):
    >5inwD (D:)
    pptvtvdrpfvvliydektravifmgrvadpk