PDB entry 5inh

View 5inh on RCSB PDB site
Description: crystal structure of autotaxin/enpp2 with a covalent fragment
Deposited on 2016-03-07, released 2017-03-15
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
    Species: Mus musculus [TaxId:10090]
    Gene: Enpp2, Npps2, Pdnp2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CA, NAG, ACT, 6C1, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5inhA (A:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafaadpggsaewdegpptvlsdspw
    tntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclktargwectkdrcgevr
    neenachcsedclsrgdcctnyqvvckgeshwvdddceeirvpecpagfvrppliifsvd
    gfrasymkkgskvmpnieklrscgthapymrpvyptktfpnlytlatglypeshgivgns
    mydpvfdatfhlrgrekfnhrwwggqplwitatkqgvragtffwsvsipherriltilqw
    lslpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktvgqlmdglkqlklhrcv
    nvifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirpkipnnlkydpkaiianl
    tckkpdqhfkpymkqhlpkrlhyannrriedlhllverrwhvarkpldvykkpsgkcffq
    gdhgfdnkvnsmqtvfvgygptfkyrtkvppfenielynvmcdllglkpapnngthgsln
    hllrtntfrptlpeevsrpnypgimylqsdfdlgctcddkvepknkleelnkrlhtkgst
    eerhllygrpavlyrtsydilyhtdfesgyseiflmplwtsytiskqaevssipehltnc
    vrpdvrvspgfsqnclaykndkqmsygflfppylssspeakydaflvtnmvpmypafkrv
    wtyfqrvlvkkyaserngvnvisgpifdynynglrdiedeikqyvegssipvpthyysii
    tscldftqpadkcdgplsvssfilphrpdndescnssedeskwveelmkmhtarvrdieh
    ltgldfyrktsrsyseiltlktylhtyeseisaenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >5inhA (A:)
    ntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclktargwectkdrcgevrn
    eenachcsedclsrgdcctnyqvvckgeshwvdddceeirvpecpagfvrppliifsvdg
    frasymkkgskvmpnieklrscgthapymrpvyptktfpnlytlatglypeshgivgnsm
    ydpvfdatfhlrgrekfnhrwwggqplwitatkqgvragtffwsvsipherriltilqwl
    slpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktvgqlmdglkqlklhrcvn
    vifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirpkipnnlkydpkaiianlt
    ckkpdqhfkpymkqhlpkrlhyannrriedlhllverrwhvarkpldvykkpsgkcffqg
    dhgfdnkvnsmqtvfvgygptfkyrtkvppfenielynvmcdllglkpapnngthgslnh
    llrtntfrptlpeevsrpnypgimgctcdgsteerhllygrpavlyrtsydilyhtdfes
    gyseiflmplwtsytiskqaevssipehltncvrpdvrvspgfsqnclaykndkqmsygf
    lfppylssspeakydaflvtnmvpmypafkrvwtyfqrvlvkkyaserngvnvisgpifd
    ynynglrdiedeikqyvegssipvpthyysiitscldftqpadkcdgplsvssfilphrp
    dndescnssedeskwveelmkmhtarvrdiehltgldfyrktsrsyseiltlktylhtye