PDB entry 5ing

View 5ing on RCSB PDB site
Description: A crotonyl-CoA reductase-carboxylase independent pathway for assembly of unusual alkylmalonyl-CoA polyketide synthase extender unit
Class: transferase
Keywords: Acyl-CoA, Crotonase, Polyketide, Extender-Unit, TRANSFERASE
Deposited on 2016-03-07, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5inga1, d5inga2
  • Chain 'B':
    Compound: Putative carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ingb1, d5ingb2
  • Chain 'C':
    Compound: Putative carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ingc1, d5ingc2
  • Chain 'D':
    Compound: Putative carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ingd1, d5ingd2
  • Chain 'E':
    Compound: Putative carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5inge1, d5inge2
  • Chain 'F':
    Compound: Putative carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ingf1, d5ingf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ingA (A:)
    mgsshhhhhhssglvprgshmasdstenlyfqgidpftmslqepvspveesptstadria
    dlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrtveagipr
    pygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpviginds
    ggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdis
    ymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvisps
    rtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ingA (A:)
    esptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefv
    rhrtprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpv
    igindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftv
    mvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtll
    gylppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleih
    pdfarniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmd
    vpgylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvm
    awptaeiavmgansavpilvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslr
    nkrqarparkhgnipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ingB (B:)
    mgsshhhhhhssglvprgshmasdstenlyfqgidpftmslqepvspveesptstadria
    dlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrtveagipr
    pygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpviginds
    ggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdis
    ymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvisps
    rtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ingB (B:)
    ptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrh
    rtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvg
    cpvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltd
    ftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvq
    tllgylppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyl
    eihpdfarniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvlt
    fmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigad
    rvmawptaeiavmgansavlvddyrrrfgnpyeaaahgyvdmvispsrtryevaralasl
    rnkrqarparkhgnipl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ingC (C:)
    mgsshhhhhhssglvprgshmasdstenlyfqgidpftmslqepvspveesptstadria
    dlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrtveagipr
    pygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpviginds
    ggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdis
    ymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvisps
    rtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ingC (C:)
    ptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrh
    rtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvg
    cpvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltd
    ftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvq
    tllgylppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyl
    eihpdfarniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvlt
    fmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigad
    rvmawptaeiavmgansavaavkenlvddyrrrfgnpyeaaahgyvdmvispsrtryeva
    ralaslrnkrqarparkhgnipl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ingD (D:)
    mgsshhhhhhssglvprgshmasdstenlyfqgidpftmslqepvspveesptstadria
    dlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrtveagipr
    pygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpviginds
    ggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdis
    ymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvisps
    rtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ingD (D:)
    stadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrt
    veagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcp
    vigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdft
    vmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtl
    lgylppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdylei
    hpdfarniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfm
    dvpgylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrv
    mawptaeiavmganyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarpa
    rkhgnipl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ingE (E:)
    mgsshhhhhhssglvprgshmasdstenlyfqgidpftmslqepvspveesptstadria
    dlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrtveagipr
    pygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpviginds
    ggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdis
    ymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvisps
    rtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ingE (E:)
    ptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrh
    rtvgiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcp
    vigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdft
    vmvkdisymfvtgpevvsageqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllg
    ylppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihp
    dfarniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdv
    pgylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvma
    wptaeiavmgansanlvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkr
    qarparkhgnipl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ingF (F:)
    mgsshhhhhhssglvprgshmasdstenlyfqgidpftmslqepvspveesptstadria
    dlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrtveagipr
    pygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpviginds
    ggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdis
    ymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvisps
    rtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ingF (F:)
    tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
    prpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigin
    dsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkd
    isymfvtgpevvsavmqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgansavrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgn
    ipl