PDB entry 5inf

View 5inf on RCSB PDB site
Description: Structural basis for acyl-CoA carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics
Class: transferase
Keywords: Polyketide, Crotonase, Extender-Unit, Acyl-CoA, TRANSFERASE
Deposited on 2016-03-07, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5infa1, d5infa2
  • Chain 'B':
    Compound: Carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5infb1, d5infb2
  • Chain 'C':
    Compound: Carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5infc1, d5infc2
  • Chain 'D':
    Compound: Carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5infd1, d5infd2
  • Chain 'E':
    Compound: Carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5infe1, d5infe2
  • Chain 'F':
    Compound: Carboxyl transferase
    Species: Streptomyces ambofaciens ATCC 23877 [TaxId:278992]
    Gene: SAM23877_7108, SAMR0483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5inff1, d5inff2
  • Heterogens: HXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5infA (A:)
    gidpftmslqepvspveesptstadriadlaarheeavvlaekkaadrqhlkgkltarar
    idllldpgsfveldefvrhrtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsm
    geafgskvvkiydfamsvgcpvigindsggariqegvmsiayytelgvrnvhssgvipqi
    slimgpcaggsvyspaltdftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaev
    sgnahyvgddeqdaiswvqtllgylppnnldpapvydhdcapgiteadlaldtvipdseq
    qvydmadvitavlddgdyleihpdfarniicalgrveghsvavvanqprhlagvldidas
    ekaarfirfcdsfnipvltfmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvit
    rkaygggyavmgsrqigadrvmawptaeiavmgansavpilhrrelaavppeeraavken
    lvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5infA (A:)
    tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
    tprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigi
    ndsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvk
    disymfvtgpevvvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppnnldp
    apvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarniica
    lgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylpgvgq
    ehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptaeiavm
    gansarrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5infB (B:)
    gidpftmslqepvspveesptstadriadlaarheeavvlaekkaadrqhlkgkltarar
    idllldpgsfveldefvrhrtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsm
    geafgskvvkiydfamsvgcpvigindsggariqegvmsiayytelgvrnvhssgvipqi
    slimgpcaggsvyspaltdftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaev
    sgnahyvgddeqdaiswvqtllgylppnnldpapvydhdcapgiteadlaldtvipdseq
    qvydmadvitavlddgdyleihpdfarniicalgrveghsvavvanqprhlagvldidas
    ekaarfirfcdsfnipvltfmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvit
    rkaygggyavmgsrqigadrvmawptaeiavmgansavpilhrrelaavppeeraavken
    lvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5infB (B:)
    tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
    tprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigi
    ndsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvk
    disymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgyl
    ppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdf
    arniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpg
    ylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawp
    taeiavmgarfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5infC (C:)
    gidpftmslqepvspveesptstadriadlaarheeavvlaekkaadrqhlkgkltarar
    idllldpgsfveldefvrhrtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsm
    geafgskvvkiydfamsvgcpvigindsggariqegvmsiayytelgvrnvhssgvipqi
    slimgpcaggsvyspaltdftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaev
    sgnahyvgddeqdaiswvqtllgylppnnldpapvydhdcapgiteadlaldtvipdseq
    qvydmadvitavlddgdyleihpdfarniicalgrveghsvavvanqprhlagvldidas
    ekaarfirfcdsfnipvltfmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvit
    rkaygggyavmgsrqigadrvmawptaeiavmgansavpilhrrelaavppeeraavken
    lvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5infC (C:)
    ptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrh
    rtprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvig
    indsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmv
    kdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgy
    lppnnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpd
    farniicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvp
    gylpgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmaw
    ptaeiavmgansarrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarpark
    hgnipl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5infD (D:)
    gidpftmslqepvspveesptstadriadlaarheeavvlaekkaadrqhlkgkltarar
    idllldpgsfveldefvrhrtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsm
    geafgskvvkiydfamsvgcpvigindsggariqegvmsiayytelgvrnvhssgvipqi
    slimgpcaggsvyspaltdftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaev
    sgnahyvgddeqdaiswvqtllgylppnnldpapvydhdcapgiteadlaldtvipdseq
    qvydmadvitavlddgdyleihpdfarniicalgrveghsvavvanqprhlagvldidas
    ekaarfirfcdsfnipvltfmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvit
    rkaygggyavmgsrqigadrvmawptaeiavmgansavpilhrrelaavppeeraavken
    lvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5infD (D:)
    tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
    tiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvig
    indsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmv
    kdisymfvtgpevvsaqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
    nldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarn
    iicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylp
    gvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptae
    iavmgarrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5infE (E:)
    gidpftmslqepvspveesptstadriadlaarheeavvlaekkaadrqhlkgkltarar
    idllldpgsfveldefvrhrtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsm
    geafgskvvkiydfamsvgcpvigindsggariqegvmsiayytelgvrnvhssgvipqi
    slimgpcaggsvyspaltdftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaev
    sgnahyvgddeqdaiswvqtllgylppnnldpapvydhdcapgiteadlaldtvipdseq
    qvydmadvitavlddgdyleihpdfarniicalgrveghsvavvanqprhlagvldidas
    ekaarfirfcdsfnipvltfmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvit
    rkaygggyavmgsrqigadrvmawptaeiavmgansavpilhrrelaavppeeraavken
    lvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5infE (E:)
    stadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrt
    vprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigi
    ndsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvk
    disymfvtgpevvgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppnn
    ldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarni
    icalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylpg
    vgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptaei
    avmgansavrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnip
    l
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5infF (F:)
    gidpftmslqepvspveesptstadriadlaarheeavvlaekkaadrqhlkgkltarar
    idllldpgsfveldefvrhrtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsm
    geafgskvvkiydfamsvgcpvigindsggariqegvmsiayytelgvrnvhssgvipqi
    slimgpcaggsvyspaltdftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaev
    sgnahyvgddeqdaiswvqtllgylppnnldpapvydhdcapgiteadlaldtvipdseq
    qvydmadvitavlddgdyleihpdfarniicalgrveghsvavvanqprhlagvldidas
    ekaarfirfcdsfnipvltfmdvpgylpgvgqehqgiirrgiklfyayaestvpkitvit
    rkaygggyavmgsrqigadrvmawptaeiavmgansavpilhrrelaavppeeraavken
    lvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5infF (F:)
    stadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhrp
    rpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigind
    sggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkdi
    symfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylpp
    nnldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfar
    niicalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgyl
    pgvgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawpta
    eiavmgansavpilhnlvddyrrrfgnpyeaaahgyvdmvispsrtryevaralaslrnk
    rqarparkhgnipl