PDB entry 5ine

View 5ine on RCSB PDB site
Description: crystal structure of the prefusion glycoprotein of lcmv
Deposited on 2016-03-07, released 2016-04-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Lymphocytic choriomeningitis mammarenavirus [TaxId:11623]
    Gene: gp-C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Lymphocytic choriomeningitis mammarenavirus [TaxId:11623]
    Gene: gp-C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ineA (A:)
    mgqivtmfealphiideviniviivliiitsikavynfatcgilalvsflflagrscgmy
    glngpdiykgvyqfksvefdmshlnltmpnacsannshhyismgssgleltftndsilnh
    nfcnltsafnkktfdhtlmsivsslhlsirgnsnhkavscdfnngitiqynlsfsdpqsa
    isqcrtfrgrvldmfrtafggkymrsgwgwagsdgkttwcsqtsyqyliiqnrtwenhcr
    yagpfgmsrilfaqektkfltrrlagtftwtlsdssgvenpggycltkwmilaaelkcfg
    ntavakcnvnhdeefcdmlrlidynkaalskfkqdvesalhvfkttvnslisdqllmrnh
    lrdlmgvpycnyskfwylehaktgetsvpkcwlvtngsylnethfsdqieqeadnmitem
    lrkdyikrqgstplalmd
    

    Sequence, based on observed residues (ATOM records):
    >5ineA (A:)
    ngpdiykgvyqfksvefdmshlnltmpnacsannshhyismgssgleltftndsilnhnf
    cnltsafnkktfdhtlmsivsslhlsirgnsnhkavscdfnngitiqynlsfsqcrtfrg
    rvldmfrtafggkymrsgwgwattwcsqtsyqyliiqnrtwenhcryagpfgmsrilfaq
    ektkflttftwtlsdssgvenpggycltkwmilaaelkcfgntavakcnvnhdeefcdml
    rlidynkaalskfkqdvesalhvfkttvnslisdqllmrnhlrdlmgvpycnyskfwyle
    haktgetsvpkcwlvtngsylnethfsdqieqeadnmitemlrkdyik
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ineB (B:)
    mgqivtmfealphiideviniviivliiitsikavynfatcgilalvsflflagrscgmy
    glngpdiykgvyqfksvefdmshlnltmpnacsannshhyismgssgleltftndsilnh
    nfcnltsafnkktfdhtlmsivsslhlsirgnsnhkavscdfnngitiqynlsfsdpqsa
    isqcrtfrgrvldmfrtafggkymrsgwgwagsdgkttwcsqtsyqyliiqnrtwenhcr
    yagpfgmsrilfaqektkfltrrlagtftwtlsdssgvenpggycltkwmilaaelkcfg
    ntavakcnvnhdeefcdmlrlidynkaalskfkqdvesalhvfkttvnslisdqllmrnh
    lrdlmgvpycnyskfwylehaktgetsvpkcwlvtngsylnethfsdqieqeadnmitem
    lrkdyikrqgstplalmd
    

    Sequence, based on observed residues (ATOM records):
    >5ineB (B:)
    ngpdiykgvyqfksvefdmshlnltmpnacsannshhyismgssgleltftndsilnhnf
    cnltsafnkktfdhtlmsivsslhlsirgnsnhkavscdfnngitiqynlsqcrtfrgrv
    ldmfrtafggkymrsgwgwagttwcsqtsyqyliiqnrtwenhcryagpfgmsrilfaqe
    ktkflagtftwtlsdpggycltkwmilaaelkcfgntavakcnvnhdeefcdmlrlidyn
    kaalskfkqdvesalhvfkttvnslisdqllmrnhlrdlmgvpycnyskfwylehaktge
    tsvpkcwlvtngsylnethfsdqieqeadnmitemlrkd