PDB entry 5in3

View 5in3 on RCSB PDB site
Description: Crystal structure of glucose-1-phosphate bound nucleotidylated human galactose-1-phosphate uridylyltransferase
Class: transferase
Keywords: GALT, UMP-GALT, glucose-1-phosphate, galactose-1-phosphate uridylyltransferase, transferase
Deposited on 2016-03-07, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5in3a1, d5in3a2
  • Chain 'B':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5in3b1, d5in3b2
  • Heterogens: ZN, H2U, EDO, G1P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5in3A (A:)
    mhhhhhhssgvdlgtenlyfqsmsrsgtdpqqrqqaseadaaaatfrandhqhirynplq
    dewvlvsahrmkrpwqgqvepqllktvprhdplnplcpgairangevnpqydstflfdnd
    fpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsvpeiravvdawasvt
    eelgaqypwvqifenkgammgcsnphphcqvwassflpdiaqreersqqayksqhgepll
    meysrqellrkerlvltsehwlvlvpfwatwpyqtlllprrhvrrlpeltpaerddlasi
    mkklltkydnlfetsfpysmgwhgaptgseaganwnhwqlhahyyppllrsatvrkfmvg
    yemlaqaqrdltpeqaaerlralpevhyhlgqkdretatia
    

    Sequence, based on observed residues (ATOM records): (download)
    >5in3A (A:)
    dhqhirynplqdewvlvsahrtvprhdplnplcpgairangevnpqydstflfdndfpal
    qpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsvpeiravvdawasvteelg
    aqypwvqifenkgammgcsnphphcqvwassflpdiaqreersqqayksqhgepllmeys
    rqellrkerlvltsehwlvlvpfwatwpyqtlllprrhvrrlpeltpaerddlasimkkl
    ltkydnlfetsfpysmgwhgaptgseaganwnhwqlhahyyppllrsatvrkfmvgyeml
    aqaqrdltpeqaaerlralpevhy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5in3B (B:)
    mhhhhhhssgvdlgtenlyfqsmsrsgtdpqqrqqaseadaaaatfrandhqhirynplq
    dewvlvsahrmkrpwqgqvepqllktvprhdplnplcpgairangevnpqydstflfdnd
    fpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsvpeiravvdawasvt
    eelgaqypwvqifenkgammgcsnphphcqvwassflpdiaqreersqqayksqhgepll
    meysrqellrkerlvltsehwlvlvpfwatwpyqtlllprrhvrrlpeltpaerddlasi
    mkklltkydnlfetsfpysmgwhgaptgseaganwnhwqlhahyyppllrsatvrkfmvg
    yemlaqaqrdltpeqaaerlralpevhyhlgqkdretatia
    

    Sequence, based on observed residues (ATOM records): (download)
    >5in3B (B:)
    atfrandhqhirynplqdewvlvsahrtvprhdplnplcpgairangevnpqydstflfd
    ndfpalqpdapspgpsdhplfqaksargvckvmcfhpwsdvtlplmsvpeiravvdawas
    vteelgaqypwvqifenkgammgcsnphphcqvwassflpdiaqreersqqayksqhgep
    llmeysrqellrkerlvltsehwlvlvpfwatwpyqtlllprrhvrrlpeltpaerddla
    simkklltkydnlfetsfpysmgwhgaptgseaganwnhwqlhahyyppllrsatvrkfm
    vgyemlaqaqrdltpeqaaerlralpevhy