PDB entry 5ims

View 5ims on RCSB PDB site
Description: Saccharomyces cerevisiae acetohydroxyacid synthase
Class: transferase
Keywords: AHAS, FAD, ThDP, O2, TRANSFERASE
Deposited on 2016-03-06, released 2017-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase catalytic subunit, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5imsa1, d5imsa2
  • Chain 'B':
    Compound: Acetolactate synthase catalytic subunit, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5imsb1, d5imsb2
  • Heterogens: K, FAD, MG, TPP, OXY, ACT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5imsA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5imsA (A:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpsnraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqi
    pvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfa
    pearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfa
    qinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwt
    wrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtp
    vkililnneehthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevd
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5imsB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5imsB (B:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllke
    lsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvt
    gniskfapearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvk
    ersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqm
    waaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelss
    avqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkq
    eeldaklkefvstkgpvllevevdkkv