PDB entry 5imh

View 5imh on RCSB PDB site
Description: d31p mutant of c69-family cysteine dipeptidase from lactobacillus farciminis
Deposited on 2016-03-06, released 2017-03-15
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidase
    Species: Lactobacillus farciminis KCTC 3681 = DSM 20184 [TaxId:936140]
    Gene: FC68_GL001211
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0R1IQH8 (Start-468)
      • engineered mutation (30)
  • Chain 'B':
    Compound: dipeptidase
    Species: Lactobacillus farciminis KCTC 3681 = DSM 20184 [TaxId:936140]
    Gene: FC68_GL001211
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0R1IQH8 (Start-468)
      • engineered mutation (30)
  • Chain 'C':
    Compound: dipeptidase
    Species: Lactobacillus farciminis KCTC 3681 = DSM 20184 [TaxId:936140]
    Gene: FC68_GL001211
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0R1IQH8 (Start-468)
      • engineered mutation (30)
  • Chain 'D':
    Compound: dipeptidase
    Species: Lactobacillus farciminis KCTC 3681 = DSM 20184 [TaxId:936140]
    Gene: FC68_GL001211
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0R1IQH8 (Start-468)
      • engineered mutation (30)
  • Chain 'E':
    Compound: dipeptidase
    Species: Lactobacillus farciminis KCTC 3681 = DSM 20184 [TaxId:936140]
    Gene: FC68_GL001211
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0R1IQH8 (Start-468)
      • engineered mutation (30)
  • Heterogens: CO, EDO, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5imhA (A:)
    mekrikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskv
    nvklpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglg
    eedlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavr
    ipddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikd
    tvynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvy
    gsgsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvnd
    tpvqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdad
    isgqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

    Sequence, based on observed residues (ATOM records):
    >5imhA (A:)
    krikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskvnv
    klpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglgee
    dlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavrip
    ddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikdtv
    ynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvygs
    gsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvndtp
    vqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdadis
    gqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5imhB (B:)
    mekrikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskv
    nvklpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglg
    eedlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavr
    ipddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikd
    tvynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvy
    gsgsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvnd
    tpvqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdad
    isgqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

    Sequence, based on observed residues (ATOM records):
    >5imhB (B:)
    krikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskvnv
    klpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglgee
    dlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavrip
    ddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikdtv
    ynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvygs
    gsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvndtp
    vqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdadis
    gqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5imhC (C:)
    mekrikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskv
    nvklpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglg
    eedlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavr
    ipddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikd
    tvynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvy
    gsgsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvnd
    tpvqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdad
    isgqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

    Sequence, based on observed residues (ATOM records):
    >5imhC (C:)
    krikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskvnv
    klpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglgee
    dlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavrip
    ddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikdtv
    ynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvygs
    gsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvndtp
    vqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdadis
    gqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5imhD (D:)
    mekrikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskv
    nvklpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglg
    eedlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavr
    ipddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikd
    tvynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvy
    gsgsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvnd
    tpvqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdad
    isgqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

    Sequence, based on observed residues (ATOM records):
    >5imhD (D:)
    krikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskvnv
    klpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglgee
    dlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavrip
    ddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikdtv
    ynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvygs
    gsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvndtp
    vqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdadis
    gqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5imhE (E:)
    mekrikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskv
    nvklpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglg
    eedlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavr
    ipddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikd
    tvynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvy
    gsgsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvnd
    tpvqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdad
    isgqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd
    

    Sequence, based on observed residues (ATOM records):
    >5imhE (E:)
    krikgsctsilvgkkasidgstlisrndpghealdpqrfvvvnpedqprdytsviskvnv
    klpddpqrytsipnsiltngiwpaaginssnvamsatetittnsrvqgldpfvenglgee
    dlvtvvlpyvksaregvkrlgslleeygtyepngisfadneevwwletigghhwaavrip
    ddayvvapnrmnidqfdfdsddtlcssdlkdlidnnnlnpdfenynlrhifgsasikdtv
    ynnprtwygqkffspddtaddpmeqdlpfichanrkisvedvkfvlsshfentkydvygs
    gsqsdktlfrpiginrnhnvhilqirnnvpteiagihwlaygantfntvvpfyanvndtp
    vqyknatgkfdlnnmywlscttallgdtdydfyvdmrndyeldamsayrkiqndtdadis
    gqkdiekylenankkladvafekqnkllgdmvttgsnnmklrynlnd