PDB entry 5imf

View 5imf on RCSB PDB site
Description: xanthomonas campestris peroxiredoxin q - structure f5
Deposited on 2016-03-06, released 2016-09-21
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin comigratory protein
    Species: Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) [TaxId:190485]
    Gene: XCC1738
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5imfA (A:)
    tdavlelpaatfdlplslsggtqttlrahaghwlviyfypkdstpgcttegldfnallpe
    fdkagakilgvsrdsvkshdnfcakqgfafplvsdgdealcrafdvikeknmygkqvlgi
    erstfllspegqvvqawrkvkvaghadavlaalkahakq
    

    Sequence, based on observed residues (ATOM records):
    >5imfA (A:)
    tdavlelpaatfdlplslsggtqttlrahaghwlviyfypkdstpgcttegldfnallpe
    fdkagakilgvsrdsvkshdnfcakqgfafplvsdgdealcrafdvikeknmygkqvlgi
    erstfllspegqvvqawrkvkvaghadavlaalkahak