PDB entry 5im8

View 5im8 on RCSB PDB site
Description: solution structure of the microtubule-targeting cos domain of mid1
Deposited on 2016-03-05, released 2016-07-13
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Midline-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MID1, FXY, RNF59, TRIM18, XPRF
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5im8A (A:)
    lkendharflqtaknitervsmatassqvlipeinlndtfdtfaldfsrekkllecldyl
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5im8A (A:)
    lkendharflqtaknitervsmatassqvlipeinlndtfdtfaldfsrekkllecldyl