PDB entry 5ils

View 5ils on RCSB PDB site
Description: Autoinhibited ETV1
Class: DNA binding protein
Keywords: ETV1, ETS, transcription factor, autoinhibition transcription, DNA binding, DNA BINDING PROTEIN
Deposited on 2016-03-04, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets translocation variant 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ETV1, ER81
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ilsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ilsA (A:)
slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
ryyyekgimqkvageryvykfvcdpealfsmafpdnqrpll