PDB entry 5ilr

View 5ilr on RCSB PDB site
Description: H64Q sperm whale myoglobin with a Fe-chlorophenyl moiety
Class: oxygen transport
Keywords: Iron, Organometallic, Bioorganometallic, Heme, Myoglobin, Sigma-aryl, Hydrazine, Arylhydrazine, Phenylhydrazine, Iron-carbon, 3-methylphenylhydrazine, meta-tolylhydrazine, 4-chlorophenylhydrazine, para-chlorophenylhydrazine, OXYGEN TRANSPORT
Deposited on 2016-03-04, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185
    • engineered mutation (64)
    • variant (122)
  Domains in SCOPe 2.07: d5ilra_
• Heterogens: SO4, 4HE, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5ilrA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ilrA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gnfgadaqgamnkalelfrkdiaakykelgy