PDB entry 5ilr

View 5ilr on RCSB PDB site
Description: H64Q sperm whale myoglobin with a Fe-chlorophenyl moiety
Class: oxygen transport
Keywords: Iron, Organometallic, Bioorganometallic, Heme, Myoglobin, Sigma-aryl, Hydrazine, Arylhydrazine, Phenylhydrazine, Iron-carbon, 3-methylphenylhydrazine, meta-tolylhydrazine, 4-chlorophenylhydrazine, para-chlorophenylhydrazine, OXYGEN TRANSPORT
Deposited on 2016-03-04, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185
      • engineered mutation (64)
      • variant (122)
    Domains in SCOPe 2.06: d5ilra_
  • Heterogens: SO4, 4HE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ilrA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ilrA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgy