PDB entry 5ilg

View 5ilg on RCSB PDB site
Description: Crystal structure of photoreceptor dehydrogenase from Drosophila melanogaster
Class: oxidoreductase
Keywords: short-chain dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-03-04, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoreceptor dehydrogenase, isoform C
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Pdh, pcdr, CG4899, Dmel_CG4899
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KNR7 (11-270)
      • expression tag (6-10)
    Domains in SCOPe 2.07: d5ilga1, d5ilga2
  • Chain 'B':
    Compound: Photoreceptor dehydrogenase, isoform C
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Pdh, pcdr, CG4899, Dmel_CG4899
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ilgb_
  • Heterogens: MG, NAD, IPH, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ilgA (A:)
    mahhhhhhvgtsfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklra
    ahptqsvmiikmdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggi
    instlsalpymgkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyy
    qrsgikfvtvcpgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvle
    kdkngavyviegkrvypleikpqwtgkeqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ilgA (A:)
    hhvgtsfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklraahptqs
    vmiikmdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggiinstls
    alpymgkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyyqrsgik
    fvtvcpgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvlekdknga
    vyviegkrvypleikpqwtgkeqal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ilgB (B:)
    mahhhhhhvgtsfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklra
    ahptqsvmiikmdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggi
    instlsalpymgkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyy
    qrsgikfvtvcpgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvle
    kdkngavyviegkrvypleikpqwtgkeqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ilgB (B:)
    sfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklraahptqsvmiik
    mdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggiinstlsalpym
    gkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyyqrsgikfvtvc
    pgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvlekdkngavyvie
    gkrvypleikpqwtgkeq