PDB entry 5ile

View 5ile on RCSB PDB site
Description: H64A sperm whale myoglobin with a Fe-tolyl moiety
Class: oxygen transport
Keywords: Bioorganometallic, Heme, Sigma-aryl, Hydrazine, Arylhydrazine, Phenylhydrazine, Iron-carbon, 3-methylphenylhydrazine, meta-tolylhydrazine, 4-chlorophenylhydrazine, para-chlorophenylhydrazine, OXYGEN TRANSPORT
Deposited on 2016-03-03, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (64)
      • variant (122)
    Domains in SCOPe 2.06: d5ilea_
  • Heterogens: 6CQ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ileA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg