PDB entry 5il5

View 5il5 on RCSB PDB site
Description: crystal structure of the dehydratase domain of mlnd from bacillus amyloliquefaciens
Deposited on 2016-03-04, released 2017-03-29
The last revision was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MlnD
    Species: Bacillus methylotrophicus [TaxId:326423]
    Gene: mlnD, RBAM_014360
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MlnD
    Species: Bacillus methylotrophicus [TaxId:326423]
    Gene: mlnD, RBAM_014360
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5il5A (A:)
    smsapgypfakelcridaqnmgsrrmnvnndlhpyiscnisdfkaqkflinvsdtglyik
    tkyqdremfpflsqiemaraagamasgnpiikltelsfrepmlqsgsneqirivltpdnq
    gasysiekqsdssiyssgrleleggayengnihlepflsqradripheafyqrlaefgys
    csdslkaaehcvsrngqvllkikakagpkgciikpeviesvyqaviylagenagelpeni
    kectifdhetepvyvyaeqtgesdsaydvyvldnaggilmelsglvfgekpnknvrfyeh
    kwnqknplieik
    

    Sequence, based on observed residues (ATOM records):
    >5il5A (A:)
    dlhpyiscnisdfkaqkflinvsdtglyiktkyqdremfpflsqiemaraagamasgnpi
    ikltelsfrepmlqsgsneqirivltpdnqgasysiekqsdssiyssgrleleggayeng
    nihlepflsqradripheafyqrlaefgyscsdslkaaehcvsrngqvllkikakagpkg
    ciikpeviesvyqaviylagenagelpenikectifdhetepvyvyaeqdsaydvyvldn
    aggilmelsglvf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5il5B (B:)
    smsapgypfakelcridaqnmgsrrmnvnndlhpyiscnisdfkaqkflinvsdtglyik
    tkyqdremfpflsqiemaraagamasgnpiikltelsfrepmlqsgsneqirivltpdnq
    gasysiekqsdssiyssgrleleggayengnihlepflsqradripheafyqrlaefgys
    csdslkaaehcvsrngqvllkikakagpkgciikpeviesvyqaviylagenagelpeni
    kectifdhetepvyvyaeqtgesdsaydvyvldnaggilmelsglvfgekpnknvrfyeh
    kwnqknplieik
    

    Sequence, based on observed residues (ATOM records):
    >5il5B (B:)
    ndlhpyiscnisdfkaqkflinvsdtglyiktkyqdremfpflsqiemaraagamasgnp
    iikltelsfrepmlqsgsneqirivltpdnqgasysiekqsdssiyssgrleleggayen
    gnihlepflsqradripheafyqrlaefgyscsdslkaaehcvsrngqvllkikakagpk
    gciikpeviesvyqaviylagenagelpenikectifdhetepvyvyaeqtgsaydvyvl
    dnaggilmelsglvfge