PDB entry 5iku

View 5iku on RCSB PDB site
Description: Crystal structure of the Clostridium histolyticum ColG tandem collagen-binding domain s3as3b in the presence of calcium at 1.9 Angstrom resolution
Class: protein binding
Keywords: Calcium-binding protein Collagen-binding protein, PROTEIN BINDING
Deposited on 2016-03-03, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagenase
    Species: Clostridium histolyticum [TaxId:1498]
    Gene: ColG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X721 (4-239)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d5ikua1, d5ikua2, d5ikua3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ikuA (A:)
    gipgtttpitkemepnddikeangpivegvtvkgdlngsddadtfyfdvkedgdvtielp
    ysgssnftwlvykegddqnhiasgidknnskvgtfkstkgrhyvfiykhdsasnisysln
    ikglgneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldk
    kdefgvtwtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk