PDB entry 5iks

View 5iks on RCSB PDB site
Description: Wild-type sperm whale myoglobin with a Fe-phenyl moiety
Class: oxygen transport
Keywords: Bioorganometallic, Heme, Myoglobin, Sigma-aryl, Iron-carbon, Hydrazine, Arylhydrazine, Phenylhydrazine, Tolylhydrazine, 3-methylphenylhydrazine, para-chlorophenylhdrazine, 4-chlorophenylhydrazine, OXYGEN TRANSPORT
Deposited on 2016-03-03, released 2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-150)
      • conflict (121)
    Domains in SCOPe 2.08: d5iksa_
  • Heterogens: 6CO, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5iksA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgy