PDB entry 5iko

View 5iko on RCSB PDB site
Description: Crystal structure of human brain glycogen phosphorylase
Class: transferase
Keywords: gp, glycogen phosphorylase, glycogen metabolism, glycogen disease, glycosyltransferase, nucleotide-binding, allosteric enzyme, transferase
Deposited on 2016-03-03, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, brain form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ikoa_
  • Heterogens: P6G, PO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ikoA (A:)
    gshmakpltdsekrkqisvrglaglgdvaevrksfnrhlhftlvkdrnvatprdyffala
    htvrdhlvgrwirtqqhyyerdpkriyylslefymgrtlqntmvnlglqnacdeaiyqlg
    ldleeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkivngwqv
    eeaddwlrygnpwekarpeymlpvhfygrvehtpdgvkwldtqvvlampydtpvpgyknn
    tvntmrlwsakapndfklqdfnvgdyieavldrnlaenisrvlypndnffegkelrlkqe
    yfvvaatlqdiirrfksskfgcrdpvrtcfetfpdkvaiqlndthpalsipelmrilvdv
    ekvdwdkaweitkktcaytnhtvlpealerwpvsmfekllprhleiiyainqrhldhvaa
    lfpgdvdrlrrmsvieegdckrinmahlcvigshavngvarihseivkqsvfkdfyelep
    ekfqnktngitprrwlllcnpgladtivekigeefltdlsqlkkllplvsdevfirdvak
    vkqenklkfsaflekeykvkinpssmfdvhvkriheykrqllnclhvvtlynrikrdpak
    afvprtvmiggkaapgyhmakliiklvtsigdvvnhdpvvgdrlkviflenyrvslaekv
    ipaadlsqqistagteasgtgnmkfmlngaltigtmdganvemaeeagaenlfifglrve
    dvealdrkgynareyydhlpelkqavdqissgffspkepdcfkdivnmlmhhdrfkvfad
    yeaymqcqaqvdqlyrnpkewtkkvirniacsgkfssdrtiteyareiwgvepsdlqipp
    pniprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ikoA (A:)
    lgdvaevrksfnrhlhftlvkdrnvatprdyffalahtvrdhlvgrwirtqqhyyerdpk
    riyylslefymgrtlqntmvnlglqnacdeaiyqlgldleeleeieedaglgngglgrla
    acfldsmatlglaaygygiryefgifnqkivngwqveeaddwlrygnpwekarpeymlpv
    hfygrvehtpdgvkwldtqvvlampydtpvpgyknntvntmrlwsakapnddfnvgdyie
    avldrnlaenisrvlypndfegkelrlkqeyfvvaatlqdiirrfksskfgtcfetfpdk
    vaiqlndthpalsipelmrilvdvekvdwdkaweitkktcaytnhtvlpealerwpvsmf
    ekllprhleiiyainqrhldhvaalfpgdvdrlrrmsvieegdckrinmahlcvigshav
    ngvarihseivkqsvfkdfyelepekfqnktngitprrwlllcnpgladtivekigeefl
    tdlsqlkkllplvsdevfirdvakvkqenklkfsaflekeykvkinpssmfdvhvkrihe
    ykrqllnclhvvtlynrikrdpakafvprtvmiggkaapgyhmakliiklvtsigdvvnh
    dpvvgdrlkviflenyrvslaekvipaadlsqqistagteasgtgnmkfmlngaltigtm
    dganvemaeeagaenlfifglrvedvealdrkgynareyydhlpelkqavdqissgffsp
    kepdcfkdivnmlmhhdrfkvfadyeaymqcqaqvdqlyrnpkewtkkvirniacsgkfs
    sdrtiteyareiwgvepsdlqipppni