PDB entry 5ikk

View 5ikk on RCSB PDB site
Description: structure of the histone deacetylase clr3
Deposited on 2016-03-03, released 2016-04-20
The last revision was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase clr3
    Species: Schizosaccharomyces pombe 972h- [TaxId:284812]
    Gene: clr3, SPBC800.03
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, K, NO3, EDO, SO4, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ikkA (A:)
    tnnkpmsgsentlnneshemsqilkksglcydprmrfhatlsevddhpedprrvlrvfea
    ikkagyvsnvpspsdvflripareatleellqvhsqemydrvtntekmshedlanlekis
    dslyynnesafcarlacgsaietctavvtgqvknafavvrppghhaephkpggfclfnnv
    svtarsmlqrfpdkikrvlivdwdihhgngtqmafyddpnvlyvslhryengrfypgtny
    gcaencgegpglgrtvnipwscagmgdgdyiyafqrvvmpvayefdpdlvivscgfdaaa
    gdhigqflltpaayahmtqmlmgladgkvfisleggynldsistsalavaqsllgippgr
    lhttyacpqavatinhvtkiqsqywrcmrpkhfdanpkdahvdrlhdvirtyqakklfed
    wkitnmpilrdsvsnvfnnqvlcssnffqkdnllvivhesprvlgngtsetnvlnlndsl
    lvdpvslyvewamqqdwglidinipevvtdgenapvdilsevkelclyvwdnyvelsisk
    niffigggkavhglvnlassrnvsdrvkcmvnflgteplvglktaseedlptwyyrhslv
    fvsssnecwkkakrakrrygrlmqsehtetsdmmeqhyravtqyllhllqkarptsq
    

    Sequence, based on observed residues (ATOM records):
    >5ikkA (A:)
    lkksglcydprmrfhatlsehpedprrvlrvfeaikkagyvsnvpspsdvflripareat
    leellqvhsqemydkmshedlanlekisdslyynnesafcarlacgsaietctavvtgqv
    knafavvrppghhalfnnvsvtarsmlqrfpdkikrvlivdwdihhgngtqmafyddpnv
    lyvslhryengrfypgtnygcaencgegpglgrtvnipwscagmgdgdyiyafqrvvmpv
    ayefdpdlvivscgfdaaagdhigqflltpaayahmtqmlmgladgkvfisleggynlds
    istsalavaqsllgippgrlhttyacpqavatinhvtkiqsqywrcmrpkhfdanpkdah
    vdrlhdvirtyqakklfedwkitnmpilrdnnqvlcssnffqkdnllvivhesprvlgng
    tsetnvlnlndsllvdpvslyvewamqqdwglidinipevdilsevkelclyvwdnyvel
    siskniffigggkavhglvnlassrnvsdrvkcmvnflgteplvglktaseedlptwyyr
    hslvfvsssnecwkkakrakrrygrlmqsehtetsdmmeqhyravtqyllhllq