PDB entry 5ikc

View 5ikc on RCSB PDB site
Description: X-RAY STRUCTURE OF THE N-TERMINAL DOMAIN OF HUMAN DOUBLECORTIN in complex with FAB
Class: transferase
Keywords: dcx domain, ubiquitin-like fold, microtubule associated, signaling protein, transferase
Deposited on 2016-03-03, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAb 6H10 light chain
    Species: Mus musculus [TaxId:10090]
    Gene: LC
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U5BC76 (1-212)
      • expression tag (0)
      • conflict (6-7)
      • conflict (9-12)
      • conflict (14)
      • conflict (19)
      • conflict (21)
      • conflict (27)
      • conflict (29-31)
      • conflict (37)
      • conflict (45)
      • conflict (49)
      • conflict (54)
      • conflict (62)
      • conflict (66)
      • conflict (72)
      • conflict (75-76)
      • conflict (79-80)
      • conflict (84)
      • conflict (88)
      • conflict (90-93)
      • conflict (95)
      • conflict (99)
      • conflict (105)
      • conflict (107)
    Domains in SCOPe 2.07: d5ikca1, d5ikca2, d5ikca3
  • Chain 'B':
    Compound: Ighg protein
    Species: Mus musculus [TaxId:10090]
    Gene: Ighg
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q569X1 (1-214)
      • expression tag (0)
      • conflict (4)
      • conflict (8-9)
      • conflict (27)
      • conflict (31-33)
      • conflict (37)
      • conflict (49)
      • conflict (53-54)
      • conflict (56)
      • conflict (60)
      • conflict (72)
      • conflict (88)
      • conflict (92)
      • conflict (96-99)
      • conflict (103)
      • conflict (110)
  • Chain 'H':
    Compound: Ighg protein
    Species: Mus musculus [TaxId:10090]
    Gene: Ighg
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q569X1 (1-214)
      • expression tag (0)
      • conflict (4)
      • conflict (8-9)
      • conflict (27)
      • conflict (31-33)
      • conflict (37)
      • conflict (49)
      • conflict (53-54)
      • conflict (56)
      • conflict (60)
      • conflict (72)
      • conflict (88)
      • conflict (92)
      • conflict (96-99)
      • conflict (103)
      • conflict (110)
  • Chain 'L':
    Compound: MAb 6H10 light chain
    Species: Mus musculus [TaxId:10090]
    Gene: LC
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U5BC76 (1-212)
      • expression tag (0)
      • conflict (6-7)
      • conflict (9-12)
      • conflict (14)
      • conflict (19)
      • conflict (21)
      • conflict (27)
      • conflict (29-31)
      • conflict (37)
      • conflict (45)
      • conflict (49)
      • conflict (54)
      • conflict (62)
      • conflict (66)
      • conflict (72)
      • conflict (75-76)
      • conflict (79-80)
      • conflict (84)
      • conflict (88)
      • conflict (90-93)
      • conflict (95)
      • conflict (99)
      • conflict (105)
      • conflict (107)
    Domains in SCOPe 2.07: d5ikcl1, d5ikcl2, d5ikcl3
  • Chain 'M':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d5ikcm1, d5ikcm2
  • Chain 'N':
    Compound: neuronal migration protein doublecortin
    Species: Homo sapiens [TaxId:9606]
    Gene: DCX, DBCN, LISX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43602 (1-89)
      • expression tag (0)
    Domains in SCOPe 2.07: d5ikcn1, d5ikcn2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ikcA (A:)
    divmtqsqklmstsvgdrvsitckasqivdtavawyqqkpgqspkpliylasnrhtgvpd
    rftgsgsgtdftltinnvqsddladyfclqhwnypltfgagtklelkgadaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ikcL (L:)
    divmtqsqklmstsvgdrvsitckasqivdtavawyqqkpgqspkpliylasnrhtgvpd
    rftgsgsgtdftltinnvqsddladyfclqhwnypltfgagtklelkgadaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ikcL (L:)
    divmtqsqklmstsvgdrvsitckasqivdtavawyqqkpgqspkpliylasnrhtgvpd
    rftgsgsgtdftltinnvqsddladyfclqhwnypltfgagtklelkgadaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathstspivksfnrne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5ikcM (M:)
    aakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgs
    rkigsmdeleegesyvcssdnffkkveytk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ikcM (M:)
    aakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgs
    rkigsmdeleegesyvcssdnffkkveyt
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ikcN (N:)
    aakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgs
    rkigsmdeleegesyvcssdnffkkveytk