PDB entry 5ik3

View 5ik3 on RCSB PDB site
Description: Crystal structure of anti-gliadin 1002-1E03 Fab fragment
Class: immune system
Keywords: anti-gliadin antibody, celiac disease, IMMUNE SYSTEM
Deposited on 2016-03-03, released 2017-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1E03 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IK3 (0-End)
    Domains in SCOPe 2.08: d5ik3a_
  • Chain 'B':
    Compound: 1E03 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IK3 (0-220)
    Domains in SCOPe 2.08: d5ik3b1, d5ik3b2
  • Chain 'C':
    Compound: 1E03 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IK3 (0-End)
    Domains in SCOPe 2.08: d5ik3c_
  • Chain 'D':
    Compound: 1E03 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IK3 (0-End)
    Domains in SCOPe 2.08: d5ik3d1, d5ik3d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ik3A (A:)
    evqlvesggglvkpggslrlscaasgftfsnawfnwvrqapgkglewvgriktntdggtt
    dyaapvkgrftisrddskntlylqmnslktedtavyycttgeplvnhitildywgqgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik3A (A:)
    evqlvesggglvkpggslrlscaasgftfsnawfnwvrqapgkglewvgriktntdggtt
    dyaapvkgrftisrddskntlylqmnslktedtavyycttghitildywgqgtlvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ik3B (B:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyrtppltfgggtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik3B (B:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyrtppltfgggtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhvyacevthqglsspvtksfnrgec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ik3C (C:)
    evqlvesggglvkpggslrlscaasgftfsnawfnwvrqapgkglewvgriktntdggtt
    dyaapvkgrftisrddskntlylqmnslktedtavyycttgeplvnhitildywgqgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik3C (C:)
    evqlvesggglvkpggslrlscaasgftfsnawfnwvrqapgkglewvgriktntdggtt
    dyaapvkgrftisrddskntlylqmnslktedtavyycttgeplvnhitildywgqgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ik3D (D:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyrtppltfgggtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik3D (D:)
    divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyrtppltfgggtkveikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnr