PDB entry 5ik2

View 5ik2 on RCSB PDB site
Description: Caldalaklibacillus thermarum F1-ATPase (epsilon mutant)
Class: hydrolase
Keywords: Hydrolase, F1-ATPase, Complex
Deposited on 2016-03-03, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2a1, d5ik2a2, d5ik2a3
  • Chain 'B':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2b1, d5ik2b2, d5ik2b3
  • Chain 'C':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2c1, d5ik2c2, d5ik2c3
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2d1, d5ik2d2, d5ik2d3
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2e1, d5ik2e2, d5ik2e3
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2f1, d5ik2f2, d5ik2f3
  • Chain 'G':
    Compound: ATP synthase gamma chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpG, CathTA2_2808
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2g_
  • Chain 'H':
    Compound: ATP synthase epsilon chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpC, CathTA2_2806
    Database cross-references and differences (RAF-indexed):
    • Uniprot F5LA71 (Start-133)
      • engineered mutation (88)
      • engineered mutation (91)
  • Chain 'I':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2i1, d5ik2i2, d5ik2i3
  • Chain 'J':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2j1, d5ik2j2, d5ik2j3
  • Chain 'K':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2k1, d5ik2k2, d5ik2k3
  • Chain 'L':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2l1, d5ik2l2, d5ik2l3
  • Chain 'M':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2m1, d5ik2m2, d5ik2m3
  • Chain 'N':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2n1, d5ik2n2, d5ik2n3
  • Chain 'O':
    Compound: ATP synthase gamma chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpG, CathTA2_2808
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ik2o_
  • Chain 'P':
    Compound: ATP synthase epsilon chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpC, CathTA2_2806
    Database cross-references and differences (RAF-indexed):
    • Uniprot F5LA71 (0-133)
      • engineered mutation (88)
      • engineered mutation (91)
  • Heterogens: ADP, MG, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ik2A (A:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtng
    fmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2A (A:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ik2B (B:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtng
    fmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2B (B:)
    vevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteireg
    tqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhep
    lqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstv
    agvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlsk
    qaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagd
    vsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrld
    laqyrelqafdkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmddipved
    vrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ik2C (C:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtng
    fmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2C (C:)
    vevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteireg
    tqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhep
    lqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstv
    agvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlsk
    qaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagd
    vsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrld
    laqyrelqafaqfdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmdd
    ipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ik2D (D:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2D (D:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2E (E:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2F (F:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2G (G:)
    qgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtk
    dfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrk
    grdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivq
    rpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgar
    mtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ik2I (I:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtng
    fmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2I (I:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftps
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ik2J (J:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtng
    fmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2J (J:)
    vevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteireg
    tqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhep
    lqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstv
    agvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlsk
    qaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagd
    vsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrld
    laqyrelqadkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmddipvedv
    rrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftps
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ik2K (K:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtng
    fmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik2K (K:)
    evvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteir
    egtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvh
    eplqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqs
    tvagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddl
    skqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqa
    gdvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlr
    ldlaqyrelqafaqfgdkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2L (L:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2M (M:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2N (N:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ik2O (O:)
    qgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtk
    dfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrk
    grdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivq
    rpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgar
    mtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

  • Chain 'P':
    No sequence available.