PDB entry 5ik1

View 5ik1 on RCSB PDB site
Description: Open state of P450cam after soaking in camphor
Class: oxidoreductase
Keywords: conformational state, structural change, crystal contact, OXIDOREDUCTASE
Deposited on 2016-03-03, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (0-405)
      • engineered mutation (325)
    Domains in SCOPe 2.06: d5ik1a_
  • Heterogens: HEM, CAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ik1A (A:)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
    nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
    gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
    gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
    gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
    vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ik1A (A:)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipsmdppeqrqfralanqvvgmpvvdklenriqelacslie
    slrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakeal
    ydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfs
    meflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlkkgdqill
    pqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlkewltripd
    fsiapgaqiqhksgivsgvqalplvwdpattkav