PDB entry 5ijz

View 5ijz on RCSB PDB site
Description: Crystal strcuture of glutamate dehydrogenase(GDH) from Corynebacterium glutamicum
Class: oxidoreductase
Keywords: glutamate dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-03-03, released 2016-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijza1, d5ijza2
  • Chain 'B':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzb1, d5ijzb2
  • Chain 'C':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzc1, d5ijzc2
  • Chain 'D':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzd1, d5ijzd2
  • Chain 'E':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijze1, d5ijze2
  • Chain 'F':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzf1, d5ijzf2
  • Chain 'G':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzg1, d5ijzg2
  • Chain 'H':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzh1, d5ijzh2
  • Chain 'I':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzi1, d5ijzi2
  • Chain 'J':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzj1, d5ijzj2
  • Chain 'K':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzk1
  • Chain 'L':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: gdh, Cgl2079, cg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijzl1, d5ijzl2
  • Heterogens: NAP, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzA (A:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzB (B:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzC (C:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzD (D:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzE (E:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzF (F:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzG (G:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzH (H:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzI (I:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzJ (J:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ijzK (K:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijzK (K:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgpgkaanaggvat
    salemqqnasrdswsfeytderlqvimknifktcaetaaeygvvganiagfkkvadamla
    qgvi
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ijzL (L:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeveg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi