PDB entry 5iji

View 5iji on RCSB PDB site
Description: fragment of nitrate/nitrite sensor histidine kinase narq (wt) in symmetric holo state
Deposited on 2016-03-02, released 2017-05-31
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrate/nitrite sensor histidine kinase NarQ
    Species: Escherichia coli [TaxId:562]
    Gene: narQ, b2469, JW2453
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LFA, NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ijiA (A:)
    mivkrpvsaslaraffyivllsilstgialltlasslrdaeainiagslrmqsyrlgydl
    qsgspqlnahrqlfqqalhspvltnlnvwyvpeavktryahlnanwlemnnrlskgdlpw
    yqaninnyvnqidlfvlalqhyaerkmllvvaislaggigiftlvfftlrrirhqvvapl
    nqlvtasqriehgqfdsppldtnlpnelgllaktfnqmsselhklyrslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ijiA (A:)
    mivkrpvsaslaraffyivllsilstgialltlasslrdaeainiagslrmqsyrlgydl
    qsgspqlnahrqlfqqalhspvltnlnvwyvpeavktryahlnanwlemnnrlskgdlpw
    yqaninnyvnqidlfvlalqhyaerkmllvvaislaggigiftlvfftlrrirhqvvapl
    nqlvtasqriehgqfdsppldtnlpnelgllaktfnqmsselhklyr