PDB entry 5iiz

View 5iiz on RCSB PDB site
Description: xanthomonas campestris peroxiredoxin q - structure f0
Deposited on 2016-03-01, released 2016-09-21
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin comigratory protein
    Species: Xanthomonas campestris pv. raphani 756C [TaxId:990315]
    Gene: bcp, XCR_1978
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iizA (A:)
    tdavlelpaatfdlplslsggtqttlrahaghwlviyfypkdstpgcttegldfnallpe
    fdkagakilgvsrdsvkshdnfcakqgfafplvsdgdealcrafdvikeknmygkqvlgi
    erstfllspegqvvqawrkvkvaghadavlaalkahakq
    

    Sequence, based on observed residues (ATOM records):
    >5iizA (A:)
    davlelpaatfdlplslsggtqttlrahaghwlviyfypkdstpgcttegldfnallpef
    dkagakilgvsrdsvkshdnfcakqgfafplvsdgdealcrafdvikeknmygkqvlgie
    rstfllspegqvvqawrkvkvaghadavlaalkahak