PDB entry 5iix

View 5iix on RCSB PDB site
Description: Crystal structure of Equine Serum Albumin in the presence of 15 mM zinc at pH 6.5
Class: transport protein
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, TRANSPORT PROTEIN
Deposited on 2016-03-01, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35747 (Start-582)
      • see remark 999 (559)
    Domains in SCOPe 2.06: d5iixa1, d5iixa2, d5iixa3
  • Heterogens: ZN, UNL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iixA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgaedkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iixA (A:)
    hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaenc
    dkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaq
    caafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccplaclipkldalke
    rillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecch
    gdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaa
    dfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadpp
    acyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlveig
    rtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaerrpc
    fsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeqlktv
    lgnfsafvakccgaedkeacfaeegpklvassqlala