PDB entry 5iio

View 5iio on RCSB PDB site
Description: crystal structure of the dna polymerase lambda binary complex
Deposited on 2016-03-01, released 2016-08-17
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*gp*cp*(8og)p*gp*tp*ap*cp*tp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA (5'-d(*cp*gp*gp*cp*(8og)p*gp*tp*ap*cp*tp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'G':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'H':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'I':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA (5'-d(*cp*gp*gp*cp*(8og)p*gp*tp*ap*cp*tp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'K':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'L':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'M':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: DNA (5'-d(*cp*gp*gp*cp*(8og)p*gp*tp*ap*cp*tp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'O':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'P':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iioA (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpg
    pgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnth
    gckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records):
    >5iioA (A:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5iioE (E:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpg
    pgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnth
    gckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records):
    >5iioE (E:)
    nhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrma
    ekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslt
    tqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdv
    lithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrld
    iivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrv
    lptptekdvfrllglpyrepaerdw
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5iioI (I:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpg
    pgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnth
    gckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records):
    >5iioI (I:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5iioM (M:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpg
    pgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnth
    gckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records):
    >5iioM (M:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.